DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc9

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001002433.1 Gene:dnajc9 / 436706 ZFINID:ZDB-GENE-040718-130 Length:252 Species:Danio rerio


Alignment Length:155 Identity:43/155 - (27%)
Similarity:69/155 - (44%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP---DAGDKFKEISFAYEVLSDPEKRRIYDRY 66
            |||:||.|..:|.|.||::.|.|::.:.|||:.|   .|..||:.:...|.||:|.|:|.:||..
Zfish    15 NLYEVLGVCKEAPDSEIRRGYYKVSLQVHPDRAPGDQSATTKFQVLGKVYAVLADKEQRAVYDEQ 79

  Fly    67 GLKGLQEGAEGFSDASEFFAQW---FPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEY 128
            |:  :.|.:........:...|   ||              |:.::..|..|:.|.|..::..:.
Zfish    80 GI--VDEESVSLDQDRNWEEHWRRLFP--------------KITLQDILDFEKQYKGSDEEVEDL 128

  Fly   129 NRQKLCSKCNGDGGPKEAHESCETC 153
            .|..|    ..:|...:..||...|
Zfish   129 KRVYL----QHEGDMDQIMESALCC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 43/155 (28%)
DnaJ 5..64 CDD:278647 25/61 (41%)
DnaJ_C 106..329 CDD:199909 10/48 (21%)
DnaJ_zf 134..197 CDD:199908 4/20 (20%)
dnajc9NP_001002433.1 DnaJ 15..77 CDD:278647 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.