DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and jdp

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster


Alignment Length:191 Identity:48/191 - (25%)
Similarity:71/191 - (37%) Gaps:63/191 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGD-----KFKEISFAYEVLSDPEKRRI 62
            |.:.|.:|....:::.|:|:..|:.||.::|||||  :||     ||:::..|.|.|.|||||.|
  Fly    15 NEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKN--SGDKEAEAKFQQLKEAKETLCDPEKRAI 77

  Fly    63 YDRYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKV- 126
            ||::...|:          |..:.||.                               |||:.| 
  Fly    78 YDKWRNSGI----------SMSYKQWL-------------------------------GMKEHVG 101

  Fly   127 EYNRQKLCSKCNGDG----GPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFT 183
            :..|..:..|.:.:.    .||.........|||......|..|          |...|.|
  Fly   102 QVRRYTIAEKVDKESMHWVTPKTKDRMLPETGGAAAQGPGTGAG----------CSSGGLT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 48/191 (25%)
DnaJ 5..64 CDD:278647 25/63 (40%)
DnaJ_C 106..329 CDD:199909 16/83 (19%)
DnaJ_zf 134..197 CDD:199908 11/54 (20%)
jdpNP_651807.1 DnaJ 17..79 CDD:278647 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.