DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG17187

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster


Alignment Length:117 Identity:41/117 - (35%)
Similarity:61/117 - (52%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYD 64
            ::||||:|.::.::...||:|.|||.|.|.|||||||   |.::|.|:|.|.|:|:|...|..||
  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72

  Fly    65 RYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEE 116
            :. ||.                      :.::|.|.|:......|::|.|||
  Fly    73 KV-LKA----------------------KKAAELRSRQLDGKRQKLKLELEE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 41/117 (35%)
DnaJ 5..64 CDD:278647 29/61 (48%)
DnaJ_C 106..329 CDD:199909 5/11 (45%)
DnaJ_zf 134..197 CDD:199908
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/61 (48%)
RRM_DNAJC17 175..247 CDD:240875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.