DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajb6b

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_009301640.1 Gene:dnajb6b / 393275 ZFINID:ZDB-GENE-040426-1122 Length:311 Species:Danio rerio


Alignment Length:319 Identity:84/319 - (26%)
Similarity:114/319 - (35%) Gaps:123/319 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |.:|.|...|:.::|||.|||||.::||||||    :|..:|||||.|||||||..|||.|||||
Zfish     6 YHILGVTKSASPDDIKKAYRKLALKWHPDKNPNDKEEAEKRFKEISEAYEVLSDENKRRDYDRYG 70

  Fly    68 LKGLQEGAEGFSDA--------------SEF------FAQWFPFDRVSSEGRGRRNGKVVVKVEL 112
            .:||......:.|.              .||      ||.:|..|.......|||:         
Zfish    71 KQGLSNRGGHYDDEYMGGFTFRNPEDVFREFFGGHDPFADFFADDTFEGFFGGRRH--------- 126

  Fly   113 TLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTC 177
                   .||.:                                .|.|...|.|.|||..:....
Zfish   127 -------RGMSR--------------------------------SRTAGPFFPGFSPFGPSFSGF 152

  Fly   178 D----------GRGFTIRDDKKCSPCQGSG-------------FVEQK---MKRDLVVERGAPHM 216
            |          |..|:   ....||..|.|             |:..|   .||  :||.|..  
Zfish   153 DTGFSPFGPMGGGSFS---SFSSSPFGGGGGMRNFTSISTSTKFINGKRITTKR--IVENGQE-- 210

  Fly   217 LKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANL---------YMRDLEINITE 266
             :|....:| |::.       :.::.:.....:||..|.         |:|::..|.:|
Zfish   211 -RVEVEEDG-QLKS-------LTVNAISDDSEERRRQNTLCGPAPHNRYLRNVAQNPSE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 84/319 (26%)
DnaJ 5..64 CDD:278647 34/60 (57%)
DnaJ_C 106..329 CDD:199909 33/196 (17%)
DnaJ_zf 134..197 CDD:199908 13/72 (18%)
dnajb6bXP_009301640.1 DnaJ 4..67 CDD:278647 34/60 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.