DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG7387

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster


Alignment Length:409 Identity:108/409 - (26%)
Similarity:169/409 - (41%) Gaps:96/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.|...||.::|:..:..|||.:|||.  :......|:|:|.||.:|:|..||..||:.|  
  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLG-- 164

  Fly    70 GLQEGAEGFSDASEFF-------------AQWFPFDRVSSEGRGRRNGKVVVKVELTLE--EIYV 119
                   |..|...|.             |:.|..|:.:::...:....   :.:|.|:  |..|
  Fly   165 -------GIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSN---EFDLPLDFLEATV 219

  Fly   120 GGMKKKVEYNRQKLCSKCNGDGGPKEAH-----ESCETCGGAGRAAAF--TFMGLSPFDTTCPTC 177
             |.||::|....:.|..|.|. ....||     |.|..|.|.|:....  ||..::    ||..|
  Fly   220 -GCKKRIELRYLRKCETCKGK-SQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVN----TCTQC 278

  Fly   178 DGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVIS- 241
            .|:.||.|:|  |..|...|||...:  |:        |:.||        .|...||::.:|: 
  Fly   279 KGKRFTNRND--CETCSNRGFVVSNV--DV--------MVSVP--------SGSRDGDVVNIINP 323

  Fly   242 ----QMEHPI------FQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHN 296
                |:.:.:      :.||..|..:.|..:||:||:.|.|...:.| ..:|.||..|| ...|.
  Fly   324 ETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL-YESVELRVEPG-TQSHT 386

  Fly   297 QIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQM 361
            |: ::.|.|:   ......|:..:..||:.|.|       |::.:     ||.::....||:...
  Fly   387 QV-VLNGKGV---RSREGVGNHIVTLKVRIPRN-------LSVKQ-----RQLVLALSQAEDPVF 435

  Fly   362 TDYKPQPRQQEDEDGQSSH 380
                 :|:.:..|.|..||
  Fly   436 -----EPKTKSTEAGNLSH 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 103/390 (26%)
DnaJ 5..64 CDD:278647 22/58 (38%)
DnaJ_C 106..329 CDD:199909 66/242 (27%)
DnaJ_zf 134..197 CDD:199908 22/69 (32%)
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 101/384 (26%)
DnaJ 101..161 CDD:278647 22/58 (38%)
DnaJ_zf 233..296 CDD:199908 22/69 (32%)
DnaJ_C 298..416 CDD:199909 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.