DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG12020

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster


Alignment Length:387 Identity:85/387 - (21%)
Similarity:138/387 - (35%) Gaps:123/387 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEF--HPDKNPD-----------------AGD--KFKEI 47
            |:.|.||.....||.|:|...||:||...  |.||..:                 .|:  ::..:
  Fly     6 LDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYV 70

  Fly    48 SFAYEVLSDPEKRRIYDRYGLKGLQEGA---EGFSDASEF-----------FAQWFPF----DRV 94
            :.|::||.:...|.||||:|..||.||.   .|:....::           |..:.|:    |.:
  Fly    71 NMAFDVLGNDLYRAIYDRFGEAGLFEGVMLPNGYFPPYQYDGDHMKVYERVFGSYSPYANVIDAI 135

  Fly    95 SS---------EGRGRRNGKVVVK--VELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEAHE 148
            |:         .|.|.|:.....:  :||:|||:..|.: |.:...||::.          :|.|
  Fly   136 SNPPSLYATRQHGIGVRSKDASTERIIELSLEEVRTGCV-KLMNVWRQEIV----------DAKE 189

  Fly   149 SCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGA 213
            |                                   |.:|:            |....|.:..|.
  Fly   190 S-----------------------------------RLEKR------------KHTLKLNIAPGT 207

  Fly   214 PHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHL 278
            ....:..|..||.:......||:|.:.:...||.|:||:.:..:....|.:.:|..|::.....|
  Fly   208 TAGTRFCFKEEGDRYPATIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTL 272

  Fly   279 DGRNVCLRTYPGEVLQHNQIKMVRGSGMP-------------VFNKATDSGDLYMKFKVKFP 327
            |.|.  |:....:|:|....|:|...|:|             ...|....|||.::|...||
  Fly   273 DRRQ--LKVVITDVVQPGYTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 85/387 (22%)
DnaJ 5..64 CDD:278647 20/79 (25%)
DnaJ_C 106..329 CDD:199909 48/237 (20%)
DnaJ_zf 134..197 CDD:199908 5/62 (8%)
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 84/386 (22%)
DnaJ 7..87 CDD:278647 20/79 (25%)
DnaJ_C 156..335 CDD:199909 48/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.