DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajc5g

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_017449734.1 Gene:Dnajc5g / 366567 RGDID:1307426 Length:186 Species:Rattus norvegicus


Alignment Length:95 Identity:44/95 - (46%)
Similarity:58/95 - (61%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP---DAGDKFKEISFAYEVLSDPEKRRIY 63
            |..:||.||::...|..|||||.|||||.::||||||   .|.:.||:|:.|:.||:||.|::||
  Rat    14 DGKSLYAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGNSQAAEFFKDINAAHAVLTDPTKKKIY 78

  Fly    64 DRYGLKGL----QEGAEGFSDASEFFAQWF 89
            ||:|..||    ..|.||........:.||
  Rat    79 DRHGSLGLYLYDHFGEEGVRTYFIVNSCWF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 44/95 (46%)
DnaJ 5..64 CDD:278647 32/61 (52%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
Dnajc5gXP_017449734.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.