DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG8531

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:481 Identity:110/481 - (22%)
Similarity:163/481 - (33%) Gaps:140/481 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPDAGDKFKEISF-----AYEVLSDPEKRRI 62
            |.|..|.:..|||.|:|...|||.::.|||||  :||: .|..||.|     ||||||||::|.|
  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDS-KKMAEIMFNRTKRAYEVLSDPQQRAI 78

  Fly    63 YDRYGLKGLQEGAEGF---------SDASEFFAQWFPFDRVSSEGRGRR-------NGKVVVKVE 111
            ||..|.|||:  .||:         .:..|      .::|::.....||       .|.:.:.|.
  Fly    79 YDSVGEKGLR--TEGWEILHRTKTPDEIRE------EYERLAQAAAERRLQQRTNPRGNITINVN 135

  Fly   112 LT----------LEEIYVGGM------------KKKVEYNRQKLCSKCNGDGGPKEAHES----- 149
            .|          :..:.:|.|            |..:..:.....|..||.||...|...     
  Fly   136 ATEIFAPYDDSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRLLNKG 200

  Fly   150 -CETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGA 213
             .|.|.|||........|............|.....||       ||   |...:...|.|:.. 
  Fly   201 WIELCAGAGNGFLLGLKGGRTLSQKLTLNGGTNLNFRD-------QG---VIPALFSTLAVQLD- 254

  Fly   214 PHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHL 278
            .|.:.....|.|.|             |.|...|...:........|.|.......|.|:..|.:
  Fly   255 KHTMGSLTLNAGSQ-------------SSMSTQIDHSKETYSLSSSLVIGTPHVYFGLSYTRKMM 306

  Fly   279 DGR-------NVCLRTYPGE------VLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDND 330
            :..       .|....:.||      |.:::.:......|:|       || :.:|||:...:..
  Fly   307 ENELKLKLAAKVGTFGFMGEYGVEKKVSKYSSVTATVSIGVP-------SG-VILKFKILRSNQS 363

  Fly   331 FATAPQLAMLEDLLPP----------------RQPIVIPKNAE----EVQMTDYKPQPRQQEDED 375
            :.....|:  ::::|.                ::.::.|..||    ||:.|     .||.|...
  Fly   364 YVFPIHLS--DEIVPAAVFYASVTPVIAWFFIKRTVMDPMEAERKNIEVERT-----KRQNEQRL 421

  Fly   376 GQSSHFEGVQCQTAXCMWLWLLQARY 401
            ....|    :...|    :.|:||.|
  Fly   422 SAKRH----EASAA----VHLMQATY 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 100/441 (23%)
DnaJ 5..64 CDD:278647 32/65 (49%)
DnaJ_C 106..329 CDD:199909 48/263 (18%)
DnaJ_zf 134..197 CDD:199908 17/68 (25%)
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 38/78 (49%)
DnaJ 15..80 CDD:278647 32/65 (49%)
DUF3395 409..538 CDD:288708 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.