DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajc9

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001102335.1 Gene:Dnajc9 / 364240 RGDID:1305009 Length:259 Species:Rattus norvegicus


Alignment Length:99 Identity:32/99 - (32%)
Similarity:54/99 - (54%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK-----NPDAGDKFKEISFAYEVLSDPEKRRIYD 64
            :||.||.|..:|:|.|:::.|.|::.:.|||:     ..||..:|:.:...|.||||.|::.:||
  Rat    15 DLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVKEDQKEDATRRFQILGRVYAVLSDKEQKAVYD 79

  Fly    65 RYGLKGLQEGAEGFSDASEFFAQW-FPFDRVSSE 97
            ..|.  :.|.:.|.....::.|.| ..|.::|.|
  Rat    80 EQGT--VDEDSAGLHQDRDWDAYWRLLFKKISLE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 32/99 (32%)
DnaJ 5..64 CDD:278647 22/63 (35%)
DnaJ_C 106..329 CDD:199909
DnaJ_zf 134..197 CDD:199908
Dnajc9NP_001102335.1 DnaJ 15..79 CDD:278647 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.