DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajc16

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:132 Identity:53/132 - (40%)
Similarity:69/132 - (52%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.|:..|:..:|||.|:|||:|:|||||.|.|  |||.:||.|||:||:.|||..||.||..
  Rat    31 YRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRTNYDHYGDA 95

  Fly    70 GLQEG------------AEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGM 122
            |..:|            .|.|.....||  .|||   :||.|...:.|.::.....:.|:.....
  Rat    96 GENQGYQQQREYRFRHFHENFYFDESFF--HFPF---NSERRDSIDEKYLLHFSHYVNEVVPDSF 155

  Fly   123 KK 124
            ||
  Rat   156 KK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 53/132 (40%)
DnaJ 5..64 CDD:278647 33/58 (57%)
DnaJ_C 106..329 CDD:199909 3/19 (16%)
DnaJ_zf 134..197 CDD:199908
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 33/58 (57%)
TRX_DnaJ 133..242 CDD:239261 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.