DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-H and Dnajb6

DIOPT Version :9

Sequence 1:	NP_001260431.1	Gene:	DnaJ-H / 34707	FlyBaseID:	FBgn0032474	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	XP_006235925.1	Gene:	Dnajb6 / 362293	RGDID:	1308207	Length:	364	Species:	Rattus norvegicus

Alignment Length:	133	Identity:	50/133 - (37%)
Similarity:	69/133 - (51%)	Gaps:	31/133 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYEVLSDPEKRRIYD 64
            ::.|:||.|...|:.|:|||.|||.|.::||||||    :|..|||:::.|||||||.:||.|||
  Rat     2 VDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYD 66

  Fly    65 RYGLKGLQEGAEG--------------FSDASEFFAQWF-------------PFDRVSSEGRGRR 102
            :||.:||..|..|              |.:..:.|.::|             |||......||.|
  Rat    67 KYGKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPR 131

  Fly   103 NGK 105
            ..:
  Rat   132 GSR 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-H	NP_001260431.1	DnaJ	1..363	CDD:223560	50/133 (38%)
		DnaJ	5..64	CDD:278647	33/62 (53%)
		DnaJ_C	106..329	CDD:199909	50/133 (38%)
		DnaJ_zf	134..197	CDD:199908
Dnajb6	XP_006235925.1	DnaJ	2..>107	CDD:223560	44/104 (42%)
Dnajb6	XP_006235925.1	DnaJ	3..66	CDD:278647	33/62 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910