DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-H and Dnajc4

DIOPT Version :9

Sequence 1:	NP_001260431.1	Gene:	DnaJ-H / 34707	FlyBaseID:	FBgn0032474	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	XP_008758381.1	Gene:	Dnajc4 / 361717	RGDID:	1308693	Length:	260	Species:	Rattus norvegicus

Alignment Length:	63	Identity:	30/63 - (47%)
Similarity:	39/63 - (61%)	Gaps:	3/63 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK---NPDAGDKFKEISFAYEVLSDPEKRRIYD 64
            |.|::|.|.|.|:.||||:.:...:||.|||:   ||....:|.|:|.||.|||..|.||.||
  Rat    53 NYYELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHSRFVELSEAYRVLSREESRRNYD 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-H	NP_001260431.1	DnaJ	1..363	CDD:223560	30/63 (48%)
		DnaJ	5..64	CDD:278647	28/61 (46%)
		DnaJ_C	106..329	CDD:199909
		DnaJ_zf	134..197	CDD:199908
Dnajc4	XP_008758381.1	DnaJ	53..115	CDD:395170	28/61 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910