DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb11

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:344 Identity:110/344 - (31%)
Similarity:159/344 - (46%) Gaps:62/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYDRY 66
            :.|.:|.|...|:.::|||.|||||.:.|||:|||   |.:||:::..|||||||.|||:.||.|
  Rat    25 DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTY 89

  Fly    67 GLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGR-------RNGKVVVKVELTLEEIYVGGMKK 124
            |.:||::|.:  |...:.|:.:|........|..|       |...::|.:|:||||:|.|..  
  Rat    90 GEEGLKDGHQ--SSHGDIFSHFFGDFGFMFGGAPRQQDRNIPRGSDIIVDLEVTLEEVYAGNF-- 150

  Fly   125 KVEYNRQKLCS-------KCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGF 182
             ||..|.|..:       |||.      ..|...|..|.||                       |
  Rat   151 -VEVVRNKPVARQAPGKRKCNC------RQEMRTTQLGPGR-----------------------F 185

  Fly   183 TIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPI 247
            .:..:..|..|.....|.::...::.:|.|....::.||..||.....||.|||...|..::|.|
  Rat   186 QMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRI 250

  Fly   248 FQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLR----TYPGEVLQHNQIKMVRGSGMPV 308
            |:||..:|| .::.:::.|||.|:.....||||..|.:.    |.||..|      ..:|.|:|.
  Rat   251 FERRGDDLY-TNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKL------WKKGEGLPN 308

  Fly   309 FNKATDSGDLYMKFKVKFP 327
            |:.....|.|.:.|.|.||
  Rat   309 FDNNNIKGSLIITFDVDFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 110/344 (32%)
DnaJ 5..64 CDD:278647 31/61 (51%)
DnaJ_C 106..329 CDD:199909 66/233 (28%)
DnaJ_zf 134..197 CDD:199908 11/69 (16%)
Dnajb11NP_001015021.1 DnaJ 22..344 CDD:223560 110/344 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.