DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnaja3

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001033684.2 Gene:Dnaja3 / 360481 RGDID:1306527 Length:480 Species:Rattus norvegicus


Alignment Length:382 Identity:110/382 - (28%)
Similarity:170/382 - (44%) Gaps:76/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68
            |.:|.|..:|:.::|||.|.:|||::|||.|   |.|.:||.:::.|||||||..||:.||.||.
  Rat    95 YQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS 159

  Fly    69 KGLQEGA----EGF------SDASEFFAQWF---------PFDRVSSEGRGRRNGKVVVKVELTL 114
            .|...||    :|:      .|..|.|.:.|         .|..|..:.:       ...:|||.
  Rat   160 AGFDPGASSSGQGYWRGGPSVDPEELFRKIFGEFSSSPFGDFQNVFDQPQ-------EYIMELTF 217

  Fly   115 EEIYVGGMKKKVEYNRQKLCSKCNGDG---GPKEAHESCETCGGAGRAAAFTFMGLSPF--DTTC 174
            .:. ..|:.|:...|....|.:|:|.|   |.|..|  |..|.|:|.....|    .||  .:||
  Rat   218 NQA-AKGVNKEFTVNIMDTCERCDGKGNEPGTKVQH--CHYCSGSGMETINT----GPFVMRSTC 275

  Fly   175 PTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAP--HMLKVPFANEGHQMRGGEFGDLI 237
            ..|.|||..|.:  .|..|:|:|..:||.:..:.|..|..  ..:::|....          ::.
  Rat   276 RRCGGRGSIITN--PCVVCRGAGQAKQKKRVTVPVPAGVEDGQTVRMPVGKR----------EIF 328

  Fly   238 VVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHL-DGRNVCLRTYPGEVLQHNQIKMV 301
            |.....:.|:|:|..|::: .||.|:|.:|:.|.:...:.| :..||   |.|..:....:|::.
  Rat   329 VTFRVQKSPVFRRDGADIH-SDLFISIAQAILGGTAKAQGLYETINV---TIPAGIQTDQKIRLT 389

  Fly   302 RGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEE 358
             |.|:|..| :...||.|:..|::.|..              |..||..:|...||:
  Rat   390 -GKGIPRIN-SYGYGDHYIHIKIRVPKR--------------LSSRQQNLILSYAED 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 110/382 (29%)
DnaJ 5..64 CDD:278647 28/59 (47%)
DnaJ_C 106..329 CDD:199909 62/230 (27%)
DnaJ_zf 134..197 CDD:199908 24/67 (36%)
Dnaja3NP_001033684.2 DnaJ 90..480 CDD:223560 110/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.