DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnj-13

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001366737.1 Gene:dnj-13 / 3564910 WormBaseID:WBGene00001031 Length:331 Species:Caenorhabditis elegans


Alignment Length:396 Identity:108/396 - (27%)
Similarity:160/396 - (40%) Gaps:118/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.::..|||:||||.|||:|.::|||||.:||  :|||||:.||:||||.:|::|||::|.:
 Worm     6 YKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYDQFGEE 70

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLC 134
            ||:||..|                 :..|.|                   |||..:...:...:.
 Worm    71 GLKEGGPG-----------------AGGGGG-------------------GGMHYEFRGDPMNIF 99

  Fly   135 SKCNGD------GGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDG----------RGFT 183
            |...|.      |||    ...:..||||....| ||.....|      ||          ||..
 Worm   100 SSFFGGSDPFGAGGP----GMFDLGGGAGGPNMF-FMNQGGMD------DGMFGGMHQGGRRGHA 153

  Fly   184 IRD------------------DKKCSPCQGSGFVEQKMKRD-----------LVVERGAPHMLKV 219
            .:|                  .||..       :.:|:..|           :.::.|.....|:
 Worm   154 RQDPAVLHDLSVSLEDVLKGTTKKMK-------ITRKVMTDNAQRLEDKVLTVTIKPGWKSGTKI 211

  Fly   220 PFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVC 284
            .|..||.|.......|::.||....||.|:|..::: .|..:|::..||.|.......|||.:..
 Worm   212 TFPKEGDQHPNRTPADIVFVIKDKPHPKFKREGSDI-KRVEKISLKSALTGLDIMIPTLDGADYR 275

  Fly   285 LRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQP 349
            |:.  .:|::....:.:.|.|:|.....:..|||.::|.|:||..              |.|.|.
 Worm   276 LQL--NDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQ--------------LNPTQR 324

  Fly   350 IVIPKN 355
            .||.:|
 Worm   325 EVILRN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 108/396 (27%)
DnaJ 5..64 CDD:278647 34/58 (59%)
DnaJ_C 106..329 CDD:199909 58/267 (22%)
DnaJ_zf 134..197 CDD:199908 20/96 (21%)
dnj-13NP_001366737.1 DnaJ 1..331 CDD:223560 108/396 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.