DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Tpr2

DIOPT Version :10

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_523584.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster


Alignment Length:40 Identity:12/40 - (30%)
Similarity:18/40 - (45%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 LAKELPIEEAPVERRC-----PLERCDSLGHMGGQFEKHF 399
            |.||||:..|.:.:..     .|.|..|:|.:...:.|.|
  Fly    47 LRKELPVRLANIMKEITLLPESLLRMPSVGLVSAWYVKSF 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 8/25 (32%)
Tpr2NP_523584.1 TPR repeat 49..77 CDD:276809 8/27 (30%)
TPR 55..>258 CDD:440225 7/32 (22%)
TPR repeat 82..112 CDD:276809 2/5 (40%)
TPR 190..419 CDD:440225
TPR repeat 201..225 CDD:276809
TPR repeat 231..259 CDD:276809
TPR repeat 310..344 CDD:276809
TPR repeat 349..377 CDD:276809
DnaJ_bact 402..>503 CDD:274090
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.