DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-H and dnajc21

DIOPT Version :9

Sequence 1:	NP_001260431.1	Gene:	DnaJ-H / 34707	FlyBaseID:	FBgn0032474	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	NP_956338.1	Gene:	dnajc21 / 336984	ZFINID:	ZDB-GENE-030131-8928	Length:	545	Species:	Danio rerio

Alignment Length:	131	Identity:	46/131 - (35%)
Similarity:	73/131 - (55%)	Gaps:	11/131 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN----PDAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |:||.|..||:|:::||.|||||.::|||||    .||.::||.|..||:|||||::|..||.:.
Zfish     5 YEVLGVKRDASDDDLKKAYRKLALKWHPDKNLDNAEDAAEQFKLIQAAYDVLSDPQERAWYDNHR 69

  Fly    68 LKGLQEGAEG-FSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQ 131
            ...|:.|..| :.|.|....|:|.....|..|...:....|.:      .::...:|::.|:::.
Zfish    70 EALLKGGVSGEYQDDSIDLVQFFTVTCYSGYGDDEKGFYAVYR------NVFESIVKEEKEHSKD 128

  Fly   132 K 132
            :
Zfish   129 E 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-H	NP_001260431.1	DnaJ	1..363	CDD:223560	46/131 (35%)
		DnaJ	5..64	CDD:278647	32/60 (53%)
		DnaJ_C	106..329	CDD:199909	3/27 (11%)
		DnaJ_zf	134..197	CDD:199908
dnajc21	NP_956338.1	DnaJ	3..66	CDD:278647	32/60 (53%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	122..141		1/8 (13%)
		DBINO	<183..246	CDD:290603
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	276..302
		zf-C2H2_jaz	323..348	CDD:288983
		C2H2 Zn finger	325..347	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..497
		C2H2 Zn finger	500..522	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	522..545
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910