DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnaja3a

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_005168528.1 Gene:dnaja3a / 335894 ZFINID:ZDB-GENE-030131-7837 Length:475 Species:Danio rerio


Alignment Length:426 Identity:113/426 - (26%)
Similarity:169/426 - (39%) Gaps:111/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRY 66
            :.|.:|.|...||.:||||.|.::||::|||.|   |.|.:||.:::.|||||||..||:.||.|
Zfish    91 DFYQILGVPRSATQKEIKKAYYQMAKKYHPDTNKEDPQAKEKFAQLAEAYEVLSDEVKRKQYDTY 155

  Fly    67 GLKGLQ-------------------------------EGAEGFSDASEFFAQWFPFDRVSSEGRG 100
            |..|..                               .||:||.|.:..|.|  |.:.|      
Zfish   156 GSAGFDAGRAGAGHQQYWGGGTSIDPEELFRKIFGEFSGAQGFGDFNAIFNQ--PQEYV------ 212

  Fly   101 RRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDG---GPKEAHESCETCGGAGRAAAF 162
                     :|||..:. ..|:.|::..|.:..|.:|:|.|   |.|..|  |..|.|.|.....
Zfish   213 ---------MELTFAQA-AKGVNKEITVNIEGTCQRCDGRGHEPGSKVQH--CGNCNGTGMETVN 265

  Fly   163 TFMGLSPF--DTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAP--HMLKVPFAN 223
            |    .||  .:||..|.|||..|  ...|..|:|:|..:|:....:.|..|..  ..:::|...
Zfish   266 T----GPFVMRSTCRRCGGRGSVI--TSPCIACRGTGQTKQRKTVTVPVPAGIEDGQTVRMPVGK 324

  Fly   224 EGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTY 288
            :          ::.:.....:.|||:|..|::: .|:.|::.:|:.|.:...:.| ...:.|...
Zfish   325 K----------EIFITFKVQKSPIFRRDGADIH-SDVMISVAQAILGGTIRAQGL-YETINLSIP 377

  Fly   289 PGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIP 353
            .|  .|.:|...:.|.|:|..: ....||.|:..|:|.|          .||.|           
Zfish   378 VG--TQTDQRIRLSGKGIPRVS-GYGYGDHYVHIKIKIP----------KMLTD----------- 418

  Fly   354 KNAEEVQMTDYKPQPRQQEDEDGQSSHFEGVQCQTA 389
              .:...|..|      .|||........||...||
Zfish   419 --RQRALMMSY------AEDESDVEGTVNGVTSTTA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 105/398 (26%)
DnaJ 5..64 CDD:278647 29/61 (48%)
DnaJ_C 106..329 CDD:199909 58/229 (25%)
DnaJ_zf 134..197 CDD:199908 24/67 (36%)
dnaja3aXP_005168528.1 DnaJ 89..474 CDD:223560 113/426 (27%)
DnaJ 91..153 CDD:278647 29/61 (48%)
DnaJ_C 207..416 CDD:199909 61/259 (24%)
DnaJ_zf 236..296 CDD:199908 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.