DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and DNAJA1

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001530.1 Gene:DNAJA1 / 3301 HGNCID:5229 Length:397 Species:Homo sapiens


Alignment Length:399 Identity:148/399 - (37%)
Similarity:227/399 - (56%) Gaps:25/399 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLKGL 71
            ||||.|.|:||.||:||.|||||.::||||||:.|:|||:||.|||||||.:||.:||:.|.:.:
Human     8 YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAI 72

  Fly    72 QEGAE--GFSDASEFFAQWFPFDRVSSEGRGR----RNGK-VVVKVELTLEEIYVGGMKKKVEYN 129
            :||..  ||....:.|..:|       .|.||    |.|| ||.::.:|||::| .|..:|:...
Human    73 KEGGAGGGFGSPMDIFDMFF-------GGGGRMQRERRGKNVVHQLSVTLEDLY-NGATRKLALQ 129

  Fly   130 RQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMG---LSPFDTTCPTCDGRGFTIRDDKKCS 191
            :..:|.||.|.||.|.|.|.|..|.|.|.......:|   :....:.|..|.|.|..|....:|.
Human   130 KNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCK 194

  Fly   192 PCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLY 256
            .|.|...|.:|...::.:::|.....|:.|..||.|..|.|.||:|:|:.|.:|.:|.||..:|:
Human   195 SCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLF 259

  Fly   257 MRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMK 321
            | .::|.:.|||||:......||.|.:.:.::||::::|..||.|...|||::.:..:.|.|.::
Human   260 M-CMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIE 323

  Fly   322 FKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQMTDYKPQPRQQEDEDGQSSHFE---- 382
            |||.||:|.|.:..:|::||.|||.|:.:......::|::.|:.|...::...:|::...:    
Human   324 FKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHP 388

  Fly   383 --GVQCQTA 389
              ||||||:
Human   389 RGGVQCQTS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 139/365 (38%)
DnaJ 5..64 CDD:278647 38/56 (68%)
DnaJ_C 106..329 CDD:199909 76/225 (34%)
DnaJ_zf 134..197 CDD:199908 22/65 (34%)
DNAJA1NP_001530.1 PTZ00037 2..394 CDD:240236 144/394 (37%)
CXXCXGXG motif 134..141 4/6 (67%)
CXXCXGXG motif 150..157 3/6 (50%)
CXXCXGXG motif 177..184 3/6 (50%)
CXXCXGXG motif 193..200 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.