DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajb1b

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_956067.1 Gene:dnajb1b / 327244 ZFINID:ZDB-GENE-030131-5455 Length:337 Species:Danio rerio


Alignment Length:377 Identity:98/377 - (25%)
Similarity:163/377 - (43%) Gaps:117/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.:...|:|:||||.|||.|.::|||||..||  :|||||:.||:|||||:|:.||||:|.:
Zfish     6 YSVLGIQKGASDDEIKKAYRKQALKYHPDKNKSAGAEEKFKEIAEAYDVLSDPKKKDIYDRFGEE 70

  Fly    70 GLQEGAEGFSDA----------------SEFFAQWFPFDRV-----------------SSEGRG- 100
            ||:.||.|....                ||||....||:.:                 :|.|.| 
Zfish    71 GLKGGAPGGGGGGGNYTYTFQGDPHAMFSEFFGGRNPFEHIFGHNGGMDENMETDDLFASFGMGG 135

  Fly   101 -------------------RRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEA 146
                               :::..|:..:.::|:|::. |..||::.:|::              
Zfish   136 IGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFT-GCTKKMKISRKR-------------- 185

  Fly   147 HESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVER 211
                                |:|        |||  |.|.:.|....:              |::
Zfish   186 --------------------LNP--------DGR--TTRSEDKILTVE--------------VKK 206

  Fly   212 GAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFK 276
            |.....|:.|..||.:.......|::.|:....||:::|..::: :...:|.:.|||||......
Zfish   207 GWKEGTKITFPREGDETPSNIPADVVFVLKDKPHPVYKRDGSDI-IYPAKITLKEALCGCVINVP 270

  Fly   277 HLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPD 328
            .||||.|  :....::::....:.:.|.|:|:.......|||.::::|:||:
Zfish   271 TLDGRTV--KVTSQDIVRPGMKRRLTGEGLPLPKSPDRRGDLVVEYEVRFPE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 98/377 (26%)
DnaJ 5..64 CDD:278647 34/58 (59%)
DnaJ_C 106..329 CDD:199909 46/223 (21%)
DnaJ_zf 134..197 CDD:199908 8/62 (13%)
dnajb1bNP_956067.1 DnaJ 1..328 CDD:223560 98/377 (26%)
DnaJ 4..65 CDD:278647 34/58 (59%)
DnaJ_C 160..322 CDD:199909 46/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.