DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb4

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:394 Identity:108/394 - (27%)
Similarity:172/394 - (43%) Gaps:119/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.:|.:...||||:|||.|||.|.:||||||  |.|.:||||::.||||||||:||.|||::|.:
  Rat     6 YHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE 70

  Fly    70 GLQEGAEG------------FSDASEFFAQWF----PFD----------RVSSE----------- 97
            ||:.||.|            ..|....||.:|    ||:          |.|.|           
  Rat    71 GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGANPFEIFFGRRMGGGRDSEEMEIDGDPFSAF 135

  Fly    98 ----------------GRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPKEA 146
                            .|.:::..::.:::::||||| .|..|:::.:|::              
  Rat   136 GFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIY-SGCTKRMKISRKR-------------- 185

  Fly   147 HESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVER 211
                                |:|        |||.:. .:||..:               :.:::
  Rat   186 --------------------LNP--------DGRSYR-SEDKILT---------------IEIKK 206

  Fly   212 GAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFK 276
            |.....|:.|..||.:.......|::.:|...|||.|:|..:|: :...:|::.|||||.|....
  Rat   207 GWKEGTKITFPREGDETPNSIPADIVFIIKDKEHPKFKRDGSNI-VYTAKISLREALCGCSINVP 270

  Fly   277 HLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLE 341
            .:||||:.:..  .::::....:.:.|.|:|........|||.::|.|.||  |..:|....:|.
  Rat   271 TMDGRNIPMSV--TDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFDVSFP--DVISAASKEILR 331

  Fly   342 DLLP 345
            ..||
  Rat   332 KHLP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 108/394 (27%)
DnaJ 5..64 CDD:278647 36/58 (62%)
DnaJ_C 106..329 CDD:199909 49/222 (22%)
DnaJ_zf 134..197 CDD:199908 7/62 (11%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 106/389 (27%)
DnaJ 4..65 CDD:278647 36/58 (62%)
DnaJ_C 158..320 CDD:199909 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.