DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and SPAC1071.09c

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_594359.1 Gene:SPAC1071.09c / 2542992 PomBaseID:SPAC1071.09c Length:282 Species:Schizosaccharomyces pombe


Alignment Length:146 Identity:39/146 - (26%)
Similarity:65/146 - (44%) Gaps:44/146 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPD------KNPDAGDKFKEISFAYEVLSDPEKRR 61
            :::.|.||.|..||:||.|::.|||.|.:.|||      |..:|..:|.:::.||.||||.::|:
pombe    29 DIDPYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEEKKVEARIEFDKVAIAYGVLSDKKRRK 93

  Fly    62 IYDRYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVG------ 120
            .||:.|     :..|..:|....:.:|                         |:|:|.|      
pombe    94 HYDKTG-----QLRETDADIDFDWKEW-------------------------LDELYQGVVSGET 128

  Fly   121 --GMKKKVEYNRQKLC 134
              ..|...:|:.::.|
pombe   129 LNEFKASYQYSEEEKC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 39/146 (27%)
DnaJ 5..64 CDD:278647 26/64 (41%)
DnaJ_C 106..329 CDD:199909 7/37 (19%)
DnaJ_zf 134..197 CDD:199908 1/1 (100%)
SPAC1071.09cNP_594359.1 DnaJ 31..96 CDD:278647 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.