DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and sec63

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_595985.1 Gene:sec63 / 2540961 PomBaseID:SPBC36B7.03 Length:611 Species:Schizosaccharomyces pombe


Alignment Length:462 Identity:87/462 - (18%)
Similarity:148/462 - (32%) Gaps:185/462 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNL---YDVLKVAPDATDEEIKKNYRKLAKEFHPDK--------NPDAGDKFKEISFAYEVLSDP 57
            ||:   |::|.:|...:.::::::|::|:.:|||||        ..:....:.||:.||..|:|.
pombe    94 LNIWDPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMVNTTREEVEKHYIEITNAYRALTDD 158

  Fly    58 EKRRIYDRYGL--------------KGLQEGAE-----GFSD----------------ASEFFA- 86
            :.|..|..||.              |.:.|...     ||..                .|..:. 
pombe   159 KTRENYALYGTPDVPQHISVGIALPKWISESENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTR 223

  Fly    87 ---------QWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGG 142
                     :|||                .::..|||:|:.      .:..:.::|.|....:..
pombe   224 DHVHVDTVDEWFP----------------KMETSLTLDELL------SLFASSKELTSLVPNEKN 266

  Fly   143 PKE-------AHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGF-- 198
            |||       .|.:.:......     |...||..|...            :...|.....||  
pombe   267 PKEYILKLLFDHLNRKKTNNFN-----THQILSQSDVVL------------NALLSVATAFGFAN 314

  Fly   199 -VEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEI 262
             |:..:|....:.:..|  |..||                        |:.|..|  |.|.|:  
pombe   315 PVDNVLKLWQHIVQAIP--LDAPF------------------------PLLQLPH--LLMEDV-- 349

  Fly   263 NITEALCGYSHCFKHLDGRNVC----------------LRTYPGEVLQHNQIKMVR--GSGMPVF 309
                         |:|..||:.                |..|     ..||:|.:|  .:|:|..
pombe   350 -------------KNLSIRNISSIPQFLSLSEEQTKDYLPNY-----SKNQLKEMREIANGIPRI 396

  Fly   310 NKATDSGDLYMKFKVKFPDNDFATAPQLA-MLEDLLPPRQPIVIPKNAEEVQMTDYKPQPRQQED 373
            :        .:..||...|:::.|...:| ::.||.......|:|    ||. ||......::::
pombe   397 S--------VVAAKVLVDDDEYITVGAIANLILDLKCSYGTEVVP----EVS-TDGTETATKKDE 448

  Fly   374 EDGQSSH 380
            ||.:..|
pombe   449 EDAEKYH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 82/443 (19%)
DnaJ 5..64 CDD:278647 18/69 (26%)
DnaJ_C 106..329 CDD:199909 43/250 (17%)
DnaJ_zf 134..197 CDD:199908 10/69 (14%)
sec63NP_595985.1 SEC63 1..611 CDD:227694 87/462 (19%)
DnaJ 98..164 CDD:278647 17/65 (26%)
Sec63 229..541 CDD:214946 60/327 (18%)
Nro1 <543..>599 CDD:289519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.