DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and SPBC17A3.05c

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_595587.1 Gene:SPBC17A3.05c / 2540130 PomBaseID:SPBC17A3.05c Length:403 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:42/118 - (35%)
Similarity:60/118 - (50%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDR 65
            |...|::|.:....||.||||:|:|||.:.|||||  |.|.:.||.:|.|::|||||..|..|||
pombe   111 NHQYYEILDLKKTCTDTEIKKSYKKLALQLHPDKNHAPSADEAFKMVSKAFQVLSDPNLRAHYDR 175

  Fly    66 YGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIY 118
            .|:    :.....|.||..|         ||...|........:..::.|:::
pombe   176 TGM----DPESRASAASSSF---------SSNAGGHPGFSAYPQANMSPEDLF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 42/118 (36%)
DnaJ 5..64 CDD:278647 29/60 (48%)
DnaJ_C 106..329 CDD:199909 1/13 (8%)
DnaJ_zf 134..197 CDD:199908
SPBC17A3.05cNP_595587.1 DnaJ 114..>220 CDD:223560 41/115 (36%)
DnaJ 114..174 CDD:278647 29/59 (49%)
DUF1977 295..391 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.