DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajb9

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:184 Identity:58/184 - (31%)
Similarity:80/184 - (43%) Gaps:40/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |.||:|.|...|::.:|||.:.|||.::|||||  |||..||:||:.|||.|||..:|:.||..|
  Rat    38 NYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDIIG 102

  Fly    68 LKGLQEGAEGFSDASEFFAQW-FPFDRVSSE----GRGRRNGKVVVKVELTLEEIYVGGMKKKVE 127
            ......|....|:.|.|...: |.||.:..:    |:.:....                 ||..|
  Rat   103 HSAFTNGKGQRSNGSPFEQSFNFNFDDLFKDFNLFGQNQNTRS-----------------KKHFE 150

  Fly   128 YNRQKLCSKCNGDGGPKEAHESCETCGGAG--------RAAAFTFMGLSPFDTT 173
            .:.|     ...||..::.|...|...|.|        ....|:|.|   ||:|
  Rat   151 NHFQ-----TRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSG---FDST 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 58/184 (32%)
DnaJ 5..64 CDD:278647 31/60 (52%)
DnaJ_C 106..329 CDD:199909 16/76 (21%)
DnaJ_zf 134..197 CDD:199908 12/48 (25%)
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 42/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.