DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG30156

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:205 Identity:47/205 - (22%)
Similarity:68/205 - (33%) Gaps:79/205 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKR------- 60
            |.|:||:::..||..|:|:.|.|||...|||||  |.|...|:.||.|.:.|:|.:||       
  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIAT 160

  Fly    61 -------------------------------------------RIYDRYGLKGLQEGAEGFSDAS 82
                                                       |:..|..|...|:...|...|.
  Fly   161 AVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAAL 225

  Fly    83 EFF-----------AQWFPFDRVSSEGRGRRNGKV----------------VVKVELTLEEIYVG 120
            .|.           |..|...|..|..|..|...:                :.::|:.:||:|:.
  Fly   226 VFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHIAYYMNPTTLSKYTEQQLAELEVEIEEVYIS 290

  Fly   121 GMKKKVEYNR 130
            .:|.|....|
  Fly   291 DLKHKCRQER 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 47/205 (23%)
DnaJ 5..64 CDD:278647 28/110 (25%)
DnaJ_C 106..329 CDD:199909 7/41 (17%)
DnaJ_zf 134..197 CDD:199908
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 27/60 (45%)
DUF1977 237..334 CDD:286411 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.