DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnj-22

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_505178.1 Gene:dnj-22 / 179227 WormBaseID:WBGene00001040 Length:296 Species:Caenorhabditis elegans


Alignment Length:254 Identity:62/254 - (24%)
Similarity:95/254 - (37%) Gaps:73/254 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYDR 65
            |.|.:|.:....||:||:|.||....::|||||.|    |..:|.|...|::.|.|.|||..|| 
 Worm     8 NPYKILHLEKGCTDKEIQKAYRAQCLKWHPDKNLDNKEEAERRFIEAKEAFDFLYDKEKREEYD- 71

  Fly    66 YGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGG--------- 121
                   ...|....|.|..:      :..:|..|:|. |::..:|...:|...||         
 Worm    72 -------NREERIRMAQEHHS------KRMAEADGKRK-KLIEDLEKREKEFSNGGKRSADGSTP 122

  Fly   122 ----------------MKKKVEYNRQKLCSKCNGDGGPK--------EAHESCETCGGAGRAAAF 162
                            .|:::|..|::|..:.|.:...|        |.|:..:.          
 Worm   123 MTAAQQAKKKKTDQRNFKEEIEAIRRQLEKEVNEEVKQKATLMKTEREKHQKSQE---------- 177

  Fly   163 TFMGLSP-FDTTCPTCDGRGFTIRDDKKCSPCQG-----SGFVEQK--MKRDLVVERGA 213
               .|:| ......|.:|..::..|.:|.....|     |..:|:|  .||.|..|.||
 Worm   178 ---KLTPRLLLKWKTSEGLDYSEDDIRKLFSTFGIISHISSAIEKKDRRKRILEFESGA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 62/254 (24%)
DnaJ 5..64 CDD:278647 25/62 (40%)
DnaJ_C 106..329 CDD:199909 28/149 (19%)
DnaJ_zf 134..197 CDD:199908 11/76 (14%)
dnj-22NP_505178.1 DnaJ 8..71 CDD:365959 25/62 (40%)
PRK12704 46..>178 CDD:237177 30/159 (19%)
RRM_DNAJC17 181..254 CDD:240875 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.