DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-H and dnj-1

DIOPT Version :9

Sequence 1:	NP_001260431.1	Gene:	DnaJ-H / 34707	FlyBaseID:	FBgn0032474	Length:	440	Species:	Drosophila melanogaster
Sequence 2:	NP_502122.1	Gene:	dnj-1 / 178040	WormBaseID:	WBGene00001019	Length:	401	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	49/143 - (34%)
Similarity:	71/143 - (49%)	Gaps:	34/143 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |::||:...|:|::|:|.|||||.:.||||  .|.|.:.||.:..||.||||.:|||.||:||
Worm   139 YEILKIDKKASDDDIRKEYRKLALKLHPDKCRAPHATEAFKALGNAYAVLSDTDKRRQYDQYG-- 201

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSEGRGR------RNGKVVVKVELTLEEI---YVGG---- 121
              .|.|...:          |..|....|.|.      .:|   .:.|.|.|||   :.||
Worm   202 --AEAANSHT----------PTTRRRGGGHGAFFEHDYAHG---FEAEFTPEEIFNMFFGGGFPT 251

  Fly   122 --MKKKVEYNRQK 132
              ::::..|.:|:
Worm   252 EQVRRRARYAQQQ 264

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-H	NP_001260431.1	DnaJ	1..363	CDD:223560	49/143 (34%)
		DnaJ	5..64	CDD:278647	29/58 (50%)
		DnaJ_C	106..329	CDD:199909	9/36 (25%)
		DnaJ_zf	134..197	CDD:199908
dnj-1	NP_502122.1	DnaJ	137..>260	CDD:333066	47/137 (34%)
dnj-1	NP_502122.1	DUF1977	300..397	CDD:312722
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910