DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnj-18

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:292 Identity:66/292 - (22%)
Similarity:99/292 - (33%) Gaps:124/292 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP----DAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            |.||.:|..|:.::||..|.||:|:.|||.||    :|..||.:::.|||:||..:||:.||...
 Worm    26 YKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKEEAAKKFHQVAMAYEILSSEDKRKAYDMTR 90

  Fly    68 LKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRR----NGKVVVKVELTLE------------- 115
            ::                ....|.|..|...|.||    |.|....:::..:             
 Worm    91 IR----------------TSPMPNDPSSFSNRYRRRTSSNLKQYTDIDIDYKDFEHFQRSTRRRP 139

  Fly   116 ----------EIYV--GGMKKKV---EYNRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFM 165
                      |.|.  ||.||:|   ||               :||.|...:....||||.... 
 Worm   140 QYHSHFDMPNEFYAEFGGFKKRVFKSEY---------------EEAQEKHGSMYKDGRAAQREM- 188

  Fly   166 GLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPF--------- 221
                                               ::::|.:..|:.| |..:.|.         
 Worm   189 -----------------------------------EELRRQVEREQAA-HQARYPIPTFEQIMRD 217

  Fly   222 -----ANEGHQMRGGEF------GDLIVVISQ 242
                 |:|..|...|.|      |.|.|::|:
 Worm   218 KRAKEASEARQYMAGMFVTAVIAGFLTVLLSR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 66/292 (23%)
DnaJ 5..64 CDD:278647 26/60 (43%)
DnaJ_C 106..329 CDD:199909 30/185 (16%)
DnaJ_zf 134..197 CDD:199908 7/62 (11%)
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 48/185 (26%)
DnaJ 23..>88 CDD:223560 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.