DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP001810

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_321247.5 Gene:AgaP_AGAP001810 / 1281303 VectorBaseID:AGAP001810 Length:362 Species:Anopheles gambiae


Alignment Length:256 Identity:69/256 - (26%)
Similarity:104/256 - (40%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |:||.||.||||.:|||.|:|||.:.|||||  |.|.:.||.|..|..:|:|.||||.||.||  
Mosquito   106 YEVLGVAKDATDSDIKKAYKKLALQLHPDKNHAPGAVEAFKAIGNAVAILTDAEKRRSYDLYG-- 168

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLC 134
                ..|....|:...|: :..|...|.|         .:.|.|.||::  .|....|.|.|.:.
Mosquito   169 ----SEEHHQPATARKAR-YHHDYAYSRG---------FETEFTAEELF--NMFFGAEINTQHVY 217

  Fly   135 SKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDD-KKCSPCQGSGF 198
            ::      .:..|.:.:......::....|:.|.|............|.|.|. ...:|.|....
Mosquito   218 TR------QRRFHRAEQQQYREPQSGIAAFINLLPIILLIALSMMSSFFISDPIYSLTPSQKFSV 276

  Fly   199 VEQKMKRDLVVERGAPHMLKVPF--ANEGHQMRGGEFGDLIVVISQ-----MEHPIFQRRH 252
            ..:            .:.||:|:  .:..|....|..|.|...:.:     ::|..::.|:
Mosquito   277 ARK------------TNQLKIPYYVKDNFHSEYQGSVGRLEASVEEEYLNNLKHSCYRERN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 69/256 (27%)
DnaJ 5..64 CDD:278647 33/58 (57%)
DnaJ_C 106..329 CDD:199909 26/155 (17%)
DnaJ_zf 134..197 CDD:199908 9/63 (14%)
AgaP_AGAP001810XP_321247.5 DnaJ 103..>222 CDD:223560 51/139 (37%)
DnaJ 104..165 CDD:278647 33/58 (57%)
DUF1977 262..359 CDD:286411 12/76 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.