DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP012194

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_320338.4 Gene:AgaP_AGAP012194 / 1280492 VectorBaseID:AGAP012194 Length:259 Species:Anopheles gambiae


Alignment Length:213 Identity:67/213 - (31%)
Similarity:88/213 - (41%) Gaps:81/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD----AGDKFKEISFAYEVLSDPEKRRIYD 64
            ::.|.:|.|:..||:.||||.|:|||..:|||||.|    :..:|||||.|||||||.:||||||
Mosquito     2 VDYYKILDVSRTATEAEIKKAYKKLALRWHPDKNMDNPEESNRRFKEISEAYEVLSDEKKRRIYD 66

  Fly    65 RYGLKGL----------------QEGAEG------------FSDASEFFAQWF---PFD------ 92
            :||..||                ..|:.|            |.|..:.|.::|   |||      
Mosquito    67 QYGKDGLMNNGSDRYHQSTRHRRHNGSSGMDDFEFFGFPFTFRDPEDVFREFFGGSPFDELFRSM 131

  Fly    93 ------RVSSEGR---GRRNG------------KVVVKVELT-------LEEIYV----GGMKKK 125
                  .|...||   |..||            .|:....:|       :::.:.    |||...
Mosquito   132 FSLTHIHVLRHGRRANGATNGHHHHHQRHSHPQNVISSPFMTPLMSFSLMDDFFSGAPRGGMSSV 196

  Fly   126 VEYNRQKLCSKCNGDGGP 143
            .||.        .|.|||
Mosquito   197 SEYT--------IGGGGP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 67/213 (31%)
DnaJ 5..64 CDD:278647 35/62 (56%)
DnaJ_C 106..329 CDD:199909 11/49 (22%)
DnaJ_zf 134..197 CDD:199908 4/10 (40%)
AgaP_AGAP012194XP_320338.4 DnaJ 2..>124 CDD:223560 47/121 (39%)
DnaJ 3..66 CDD:278647 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.