DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP003825

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_310387.5 Gene:AgaP_AGAP003825 / 1271565 VectorBaseID:AGAP003825 Length:308 Species:Anopheles gambiae


Alignment Length:345 Identity:74/345 - (21%)
Similarity:128/345 - (37%) Gaps:110/345 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYD 64
            ::::|.:|:|...||::||:|.|||.|.:.|||||||   |...|:|:|.|.|:|.|...|..||
Mosquito     9 DIDIYGLLEVDIAATEQEIRKAYRKKALQCHPDKNPDNPKAAQLFQELSKALEILMDVSARAAYD 73

  Fly    65 RYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYN 129
            |.                                   .|.|...::.           .|:::..
Mosquito    74 RL-----------------------------------LNAKKAAQLR-----------TKQLDSK 92

  Fly   130 RQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQ 194
            ||||  |.:.:...::|.|:..  ||...|::.|...|                .:::.|....:
Mosquito    93 RQKL--KADLEERERQAKEAAS--GGYKTASSKTPEEL----------------FQEEFKRLRKE 137

  Fly   195 GSGFVEQK---MKRDLVVE------------RGAPHMLKVPF-ANEGHQMRGG-----------E 232
            ||..::::   |:|.|..|            ..|.|.:|:.: |:.|....||           :
Mosquito   138 GSKLIQEEQELMRRQLQEELRMMQTATAPSWDPAQHRIKIRWKADRGDAANGGYTEDVLRKFLSK 202

  Fly   233 FGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGR--NVCLRTYPGEVLQH 295
            :|||..::      :..|::.:..:.....:..|....:.      .||  |.|...:.||....
Mosquito   203 YGDLNALV------MSPRKNGSALVEFRAKDAAEMAVTFE------KGRLDNPCTLEWVGEAPTK 255

  Fly   296 NQIKMVRGSGMPVFNKATDS 315
            .:.|.....|..:..:..:|
Mosquito   256 GKAKATASGGSTITERDYES 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 74/345 (21%)
DnaJ 5..64 CDD:278647 28/61 (46%)
DnaJ_C 106..329 CDD:199909 41/239 (17%)
DnaJ_zf 134..197 CDD:199908 10/62 (16%)
AgaP_AGAP003825XP_310387.5 DnaJ 11..73 CDD:278647 28/61 (46%)
RRM_DNAJC17 173..249 CDD:240875 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.