DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP007107

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_308650.4 Gene:AgaP_AGAP007107 / 1269995 VectorBaseID:AGAP007107 Length:351 Species:Anopheles gambiae


Alignment Length:388 Identity:108/388 - (27%)
Similarity:170/388 - (43%) Gaps:91/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYG 67
            :.|.:|.|:.:|:|:||||.|||||.::|||||  |.|.::|||::.|||||||.:||.|||:||
Mosquito     4 DFYKILGVSKNASDDEIKKAYRKLALKYHPDKNKAPQAEERFKEVAEAYEVLSDKKKRDIYDQYG 68

  Fly    68 LKGLQEGAEGF---------------SDASEFFAQWF----PF-------------------DRV 94
            .:||:.||.|.               .|....|||:|    ||                   |..
Mosquito    69 EEGLKGGAGGMPGAGGQSGQFQYNFHGDPRATFAQFFGTSDPFSVFFGTDGGGNIFHQEMDGDPF 133

  Fly    95 SSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYN-------RQKLCSKCNGDGGPKEAHESCET 152
            ..:|||...|.            :.||..:...:|       :|||       ..|...|:    
Mosquito   134 GFDGRGGSVGG------------FPGGAFRSQSFNVHGSPQRKQKL-------QDPPIEHD---- 175

  Fly   153 CGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHML 217
                      .::.|...:..|..      .::..|......||...|:|: ..:.|:.|.....
Mosquito   176 ----------LYVSLEDVNAGCQK------KMKISKMVMGQDGSARKEEKI-LSINVKPGWKAGT 223

  Fly   218 KVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRN 282
            |:.|..||.|:.|....|::.:|....|..|:|..::: ....:|::.:||||.......|.|..
Mosquito   224 KITFPREGDQIPGKVPADIVFIIRDKPHAHFKREGSDI-KYTAKISLRQALCGTVVKVPTLSGET 287

  Fly   283 VCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLP 345
            :.:.| .|||::.:.:|.::..|:|...:.:..|||.:.|.::|||....:..::  |.||.|
Mosquito   288 LTIST-AGEVVKPHTVKRLQNRGLPFPKEPSRRGDLVVAFDIRFPDQVSPSTKEI--LADLFP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 108/388 (28%)
DnaJ 5..64 CDD:278647 34/60 (57%)
DnaJ_C 106..329 CDD:199909 48/229 (21%)
DnaJ_zf 134..197 CDD:199908 6/62 (10%)
AgaP_AGAP007107XP_308650.4 DnaJ 1..347 CDD:223560 107/386 (28%)
DnaJ 4..65 CDD:278647 34/60 (57%)
DnaJ_C 170..332 CDD:199909 41/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.