DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP007361

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_308470.4 Gene:AgaP_AGAP007361 / 1269820 VectorBaseID:AGAP007361 Length:785 Species:Anopheles gambiae


Alignment Length:409 Identity:84/409 - (20%)
Similarity:147/409 - (35%) Gaps:132/409 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDK--FKEISFAYEVLSDPEKRRIY 63
            |.|.:.|::|.|...::.:||||.||.|:...||||  :.||:  |.:::.||:.|:|.|.|:.:
Mosquito   101 MSNFDPYEILGVPLGSSQKEIKKAYRTLSVILHPDK--ETGDEKAFMKLTKAYQALTDDEARKNW 163

  Fly    64 DRY-----------------------------GLKGL-------------------QEGAEGFSD 80
            ::|                             ||.||                   ..|.:...|
Mosquito   164 EKYGNPDGPGATSFGIALPSWIVEKENSVWVLGLYGLVFMVALPIVVGTWWYRSIRYSGDKVLLD 228

  Fly    81 ASEFFAQWFPFDR--------------VSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQ 131
            .:..:  |:.|.:              .|.|...|.|.:|   :|...:.:.|..:.:::.|..:
Mosquito   229 TTNMY--WYFFHKTPHMAVKRVIMILAASFEFEKRHNNQV---IERPSDNVEVPALIRELPYLNE 288

  Fly   132 KLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGS 196
            | |.:.     |.....|.:     .||.....:...|.:......| |...:|   ||.     
Mosquito   289 K-CKEL-----PFARSYSLK-----ARAILHAHLSRIPLNPNTLEVD-RQLIVR---KCP----- 333

  Fly   197 GFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQM--------EHPIFQRRHA 253
             ::.|:|...:      .|::.:.:|.:..::...|..:..:.:|.|        |||:.|..|.
Mosquito   334 -YLIQEMVSCV------SHLIMLAYARKIQRLPSIETIENCMKLSPMVIQGLRESEHPLMQLPHM 391

  Fly   254 NLYMRDLEINITEALCGYSHCFKHL--------DGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFN 310
            ...:|        |.....:..::|        |.|...||:...| ..||.:|::  ..||:. 
Mosquito   392 TKELR--------AQLARKYNTRNLQQLAQLKPDTRRAALRSLNDE-QYHNAVKVL--GQMPLI- 444

  Fly   311 KATDSGDLYMKFKVKFPDN 329
                  |..||.:|...:|
Mosquito   445 ------DFSMKCEVVDDEN 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 84/409 (21%)
DnaJ 5..64 CDD:278647 23/60 (38%)
DnaJ_C 106..329 CDD:199909 45/238 (19%)
DnaJ_zf 134..197 CDD:199908 11/62 (18%)
AgaP_AGAP007361XP_308470.4 DnaJ 105..164 CDD:278647 23/60 (38%)
Sec63 211..>480 CDD:304568 54/297 (18%)
Sec63 <639..734 CDD:304568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.