DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and AgaP_AGAP012747

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_307339.3 Gene:AgaP_AGAP012747 / 1268770 VectorBaseID:AGAP012747 Length:210 Species:Anopheles gambiae


Alignment Length:203 Identity:44/203 - (21%)
Similarity:71/203 - (34%) Gaps:86/203 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISF-----AYEVLSDPEKRRIYD-- 64
            |:|||:.|:.:..:::..:.:|:||.|||.|.....|:.:.||     ||:|||.||.|..||  
Mosquito    24 YNVLKLQPNCSARDVRTAFIQLSKELHPDANVSNQAKYDKKSFVELLEAYKVLSKPESRAAYDYE 88

  Fly    65 -------------------------------------RYGLKGLQEGAEGFSDASEFFAQW---- 88
                                                 .||:||:::           .:.|    
Mosquito    89 LSLSKNPGNQVYVNLLTNSTYRPWAANTMHYSNEEQPYYGIKGVKK-----------VSNWTIVL 142

  Fly    89 --------------------FPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKL 133
                                |.|.|...:...|:|.....:|.   ||....|.|.::|    ::
Mosquito   143 CCGIFMLVGIVLQAVAINKSFTFQRDQLDEYSRQNAITHAEVR---EEAEKYGNKAQIE----RM 200

  Fly   134 CSKCNGDG 141
            .:|.|.:|
Mosquito   201 KAKLNKEG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 44/203 (22%)
DnaJ 5..64 CDD:278647 23/61 (38%)
DnaJ_C 106..329 CDD:199909 9/36 (25%)
DnaJ_zf 134..197 CDD:199908 3/8 (38%)
AgaP_AGAP012747XP_307339.3 DnaJ 22..86 CDD:278647 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.