DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Dnajc14

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_446142.2 Gene:Dnajc14 / 114481 RGDID:620489 Length:703 Species:Rattus norvegicus


Alignment Length:235 Identity:62/235 - (26%)
Similarity:94/235 - (40%) Gaps:72/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYD 64
            |.||.:.||.|...|:|.|:||.||:||...|||||  |.|.:.||.:..|::::|:||:|:.|:
  Rat   441 DELNPFHVLGVEATASDIELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNPERRKEYE 505

  Fly    65 RYGLKGLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYN 129
               :|.:.|. |.....:||.:                      |::..|:|..           
  Rat   506 ---MKRMAEN-ELSRSVNEFLS----------------------KLQDDLKEAM----------- 533

  Fly   130 RQKLCSKCNG-------DGGPKEAHESCETCGGAGRA------AAFTFMGLSPFDTTCPTCDGRG 181
            ...:||:|.|       |..||.| ..|..|.....|      |..:.:||.  .|.....||: 
  Rat   534 NTMMCSRCQGKHRRFEMDREPKSA-RYCAECNRLHPAEEGDFWAESSMLGLK--ITYFALMDGK- 594

  Fly   182 FTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPF 221
              :.|..:.:.||..|.              :|...:||:
  Rat   595 --VYDITEWAGCQRVGI--------------SPDTHRVPY 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 62/235 (26%)
DnaJ 5..64 CDD:278647 27/60 (45%)
DnaJ_C 106..329 CDD:199909 27/129 (21%)
DnaJ_zf 134..197 CDD:199908 20/75 (27%)
Dnajc14NP_446142.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..229
DnaJ 444..505 CDD:278647 27/60 (45%)
Jiv90 535..621 CDD:291562 24/104 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.