DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and DNAJA2

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_005871.1 Gene:DNAJA2 / 10294 HGNCID:14884 Length:412 Species:Homo sapiens


Alignment Length:406 Identity:160/406 - (39%)
Similarity:244/406 - (60%) Gaps:30/406 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLKG 70
            |||:|.|.|.|::.|:||.|||||||:||||||:||||||||||||||||:||||.:|||||.:|
Human     9 LYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQG 73

  Fly    71 LQEGAEGFSDASEFFAQWFP---FDRVSSEGR---GRRNGK-VVVKVELTLEEIYVGGMKKKVEY 128
            |:||:.|.....:.|:..|.   |..:.::.|   |||.|: ::..::::||::| .|...|::.
Human    74 LREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLY-NGKTTKLQL 137

  Fly   129 NRQKLCSKCNGDGGPKEAHESCETCGGAGRAAAFTFMGLSP-----FDTTCPTCDGRGFTIRDDK 188
            ::..|||.|:|.||...|.:.|..|  .||........|:|     ..:.|..|:|.|..|.:..
Human   138 SKNVLCSACSGQGGKSGAVQKCSAC--RGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKD 200

  Fly   189 KCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHA 253
            :|..|:|...:::....::.|::|..|..::.|..|..|..|.|.||:::::.:.||.:|||...
Human   201 RCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGN 265

  Fly   254 NLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMPVFNKATDSGDL 318
            :|:| ..:|.:.|||||:...|||||||.:.::..||:|::...:::|||.|||.:....:.|||
Human   266 DLHM-TYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDL 329

  Fly   319 YMKFKVKFPDNDFATAPQLAMLEDLLP--PRQPIVIPKNAEEVQMTDYKP-------QPRQ---- 370
            |:||.|:||:|::....:|:.||||||  |..|.:|.: .|||::.::..       |.|:    
Human   330 YIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNIIGE-TEEVELQEFDSTRGSGGGQRREAYND 393

  Fly   371 QEDEDGQSSHFEGVQC 386
            ..||:..|.|..||||
Human   394 SSDEESSSHHGPGVQC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 150/370 (41%)
DnaJ 5..64 CDD:278647 43/57 (75%)
DnaJ_C 106..329 CDD:199909 75/227 (33%)
DnaJ_zf 134..197 CDD:199908 21/67 (31%)
DNAJA2NP_005871.1 PTZ00037 4..412 CDD:240236 160/406 (39%)
CXXCXGXG motif 143..150 4/6 (67%)
CXXCXGXG motif 159..166 3/8 (38%)
CXXCXGXG motif 186..193 3/6 (50%)
CXXCXGXG motif 202..209 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I7034
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43888
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.