powered by:
Protein Alignment DnaJ-H and zgc:152986
DIOPT Version :9
Sequence 1: | NP_001260431.1 |
Gene: | DnaJ-H / 34707 |
FlyBaseID: | FBgn0032474 |
Length: | 440 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001275586.1 |
Gene: | zgc:152986 / 101884054 |
ZFINID: | ZDB-GENE-061013-762 |
Length: | 177 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 35/73 - (47%) |
Similarity: | 46/73 - (63%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYG-L 68
|.||.|:...:..:|||.:.|||.:.||||| |:|...|..|:.|||||||.||||:||:.. |
Zfish 24 YSVLGVSRFVSSRDIKKAFHKLALKHHPDKNQTPNAQQTFTHIAQAYEVLSDREKRRVYDQMDHL 88
Fly 69 KGLQEGAE 76
....:|:|
Zfish 89 SNPDQGSE 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.