DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajb5

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:377 Identity:113/377 - (29%)
Similarity:176/377 - (46%) Gaps:74/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAG--DKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.:|.:|..|.::||||.|||:|.::|||||.||.  ||||||:.||:|||||:||.:||:||.:
 Frog    65 YKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAEAYDVLSDPKKRAVYDQYGEE 129

  Fly    70 GLQEGA-----EGFS-------DASEFFAQWF----PFDRVSSEGRGR-RNGKVVVKVELTLEE- 116
            ||:.|.     .|.|       |....||.:|    |||......|.| .||.....:::..:| 
 Frog   130 GLKTGGGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHEDMDINEDED 194

  Fly   117 -IY----------VGGMKKKVE---YNRQKLCSKCNGDGGPKEAHESC----ETCGGAGRAAAFT 163
             ::          |.|..|:.:   ::|:|:       ..|...||..    |...|..:....|
 Frog   195 DLFGGFGRFGFSGVNGFHKRHQDQLHSRRKV-------QDPPVVHELKVSLEEIYHGCTKRMKIT 252

  Fly   164 FMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQM 228
            ...|:|        |||  |:|.:.|.              .::|:::|.....|:.|..||...
 Frog   253 RRRLNP--------DGR--TVRTEDKI--------------LNVVIKKGWKEGTKITFPKEGDAT 293

  Fly   229 RGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVL 293
            ......|::.::....|.:|:|..:|: :...:|.:.|||||.:.....:|||.:.|..  .:|:
 Frog   294 SENIPADIVFLLKDKPHALFKRDGSNI-VYTAKITLKEALCGCTVNIPTIDGRVIPLPC--SDVI 355

  Fly   294 QHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLP 345
            :...:|.:||.|:|........|||.::|:|:|||.  ...|...:|:..||
 Frog   356 KPGAVKRLRGEGLPFPKVPNQRGDLIVEFQVRFPDR--IPQPTRELLKQHLP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 113/377 (30%)
DnaJ 5..64 CDD:278647 34/58 (59%)
DnaJ_C 106..329 CDD:199909 54/241 (22%)
DnaJ_zf 134..197 CDD:199908 14/66 (21%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 111/372 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.