DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajc11

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_002667092.2 Gene:dnajc11 / 100329402 -ID:- Length:560 Species:Danio rerio


Alignment Length:464 Identity:106/464 - (22%)
Similarity:171/464 - (36%) Gaps:130/464 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNLNLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD------AGDKFKEISFAYEVLSDPEK 59
            :||.:.|.:|.|..:||.||:|.:||:|...:||||:.|      |...|..:..||||||||:.
Zfish    11 VDNEDYYSLLNVRREATQEELKSSYRRLCMLYHPDKHRDPELKRQAEQLFTYVHQAYEVLSDPQS 75

  Fly    60 RRIYDRYGLKGLQ----EGAEGFSDASEFFAQWFPFDRVSSEGRGRR-------NGKVVVKVELT 113
            |.|||.:|.|||:    |..|.....:|...:   ::|:..|...||       .|.:.|.::.|
Zfish    76 RAIYDIFGKKGLEVEGWEVVERKRTPAEIREE---YERLQRERDERRLQQRTNPKGTISVGIDAT 137

  Fly   114 ---------LEEIYVGGMKKKVEYNRQKL-------------------CSKCNGDGGPK------ 144
                     .||:..||. ..:|.||..:                   .|..||:||..      
Zfish   138 DLFDRYEEDFEEVPGGGF-PHIEINRMHISQSIEAPLTTSDTAVLSGSLSTHNGNGGGNINLCVR 201

  Fly   145 ---EAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCD-----GRGFTIRDDKKCSPCQGSGFVEQ 201
               .|....|...|||......| |:..|......|.     |..|:.|..:..:....:..::|
Zfish   202 RVTSARGWGEMEFGAGDVRGPLF-GMKVFRNVTARCFVTAQWGLQFSSRGIRPSASTMMARHLDQ 265

  Fly   202 KMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITE 266
            .....|                   |.|.|.       .|.|...|.:....:.:...|::.:..
Zfish   266 NTMGYL-------------------QWRWGS-------QSAMTTSIVRDTKTSHFTLALQLGVPH 304

  Fly   267 A--LCGYSHCFKHLDGRNV--CLRT--------YPGE--VLQHNQIKMVRGSGMPV-------FN 310
            :  :..|.:.|:..|...|  .::|        |..|  :.:|:.:......|:|.       .|
Zfish   305 SYLMMSYQYKFQDEDQTKVKGSIKTGFFGTVVEYGAERKISRHSVLAATVSIGVPQGVSLKIRLN 369

  Fly   311 KATDSGDLYMKFKVKFPDN------DFATAPQLAMLEDLLPPRQPIVIPKNAEEVQMTDYKPQPR 369
            :|:.:   |: |.:...|.      .:||...||:   .|..::.|::|      .:..:|.|..
Zfish   370 RASQT---YL-FPIHLTDQILPSAVFYATVGPLAI---YLAVQKLIIMP------YVQAHKEQEL 421

  Fly   370 QQEDEDGQS 378
            :::.||..|
Zfish   422 EKQKEDSAS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 101/447 (23%)
DnaJ 5..64 CDD:278647 28/64 (44%)
DnaJ_C 106..329 CDD:199909 49/285 (17%)
DnaJ_zf 134..197 CDD:199908 17/76 (22%)
dnajc11XP_002667092.2 DnaJ 15..80 CDD:278647 28/64 (44%)
DUF3395 418..550 CDD:288708 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.