DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and dnajb4

DIOPT Version :9

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_001096404.1 Gene:dnajb4 / 100125006 XenbaseID:XB-GENE-1007708 Length:357 Species:Xenopus tropicalis


Alignment Length:358 Identity:84/358 - (23%)
Similarity:150/358 - (41%) Gaps:119/358 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD--AGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |.||.:...|::::|||.|||.|.::|||||..  |.:|||||:.||||||||:||.:||::|.:
 Frog     6 YSVLGIEKGASEDDIKKAYRKQALKWHPDKNKSAHAEEKFKEIAEAYEVLSDPKKREVYDQFGEE 70

  Fly    70 GLQEGA-----------------------------------------------------EGFSDA 81
            ||:.|:                                                     :.||..
 Frog    71 GLKGGSGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGDPFSSF 135

  Fly    82 SEFFAQWFPFDR--VSSEGRGRRNGKVVVKVELTLEEIYVGGMKKKVEYNRQKLCSKCNGDGGPK 144
            :.|....||.::  |.::.|.:::..::..:.::|||||. |..|::..:|::            
 Frog   136 TSFNMNGFPREKNQVGNQFRRKQDPPIIHDLRVSLEEIYT-GCTKRMRISRKR------------ 187

  Fly   145 EAHESCETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVV 209
                                  |:|        |||  ::|.:.|....:              :
 Frog   188 ----------------------LNP--------DGR--SVRTEDKILTIE--------------I 206

  Fly   210 ERGAPHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHC 274
            ::|.....|:.|..||.:.......|::.|:....|..|:|..:|: :..:.:::.|||||.|..
 Frog   207 KKGWKEGTKITFPREGDEAPMTIPADIVFVVKDKPHTHFKRDGSNI-VCPVRVSLREALCGCSIN 270

  Fly   275 FKHLDGRNVCLRTYPGEVLQHNQIKMVRGSGMP 307
            ...||||::.:..  .::::....:.:.|.|:|
 Frog   271 VPTLDGRSIPMTI--NDIIKPGMRRRIIGYGLP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 84/358 (23%)
DnaJ 5..64 CDD:278647 32/58 (55%)
DnaJ_C 106..329 CDD:199909 39/202 (19%)
DnaJ_zf 134..197 CDD:199908 7/62 (11%)
dnajb4NP_001096404.1 DnaJ_bact 4..307 CDD:274090 84/358 (23%)
DnaJ 4..65 CDD:278647 32/58 (55%)
DnaJ_C 160..304 CDD:199909 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.