DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmg and ZFP64

DIOPT Version :9

Sequence 1:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_060667.2 Gene:ZFP64 / 55734 HGNCID:15940 Length:681 Species:Homo sapiens


Alignment Length:583 Identity:100/583 - (17%)
Similarity:195/583 - (33%) Gaps:196/583 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ESHDN----IFSMAYEFQTK--LMPPKQAE------SLKLEQQNSSSDSEETAKSPSPDTRELVS 316
            ||::|    :.|:..:.:||  ..||.|..      ..:.:......|.|...|        :.:
Human   114 ESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLK--------IHT 170

  Fly   317 GKEQFQCQKCSYSTPIRARFKKHVKYHS-MPLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSC 380
            |.:..:|:.|......:.:.|.|::.|: :...||.:||:......:|::|.:.|.....|||..
Human   171 GDKPHKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQI 235

  Fly   381 CDFSTDIKQSLTIHESNH--HVPMPVHQMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTE 443
            |.:::.....||:|..:|  ..|........:.:..::.....:.....||  ||          
Human   236 CPYASRNSSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKP--FK---------- 288

  Fly   444 SLLPRTSGIVCSHCQKRVGNAMQLINHLQVCTLALHNTTQL-----------QASINAEVDLHDE 497
                      |..|..|......|.:|:::    .|:....           :|::.....:|..
Human   289 ----------CEFCNVRCTMKGNLKSHIRI----KHSGNNFKCPHCDFLGDSKATLRKHSRVHQS 339

  Fly   498 DFPNAPTDLSYCGVETAPGYGEVTEVLPEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLN 562
            :.|.                                     ||..||:..::.:...:|...|..
Human   340 EHPE-------------------------------------KCSECSYSCSSKAALRIHERIHCT 367

  Fly   563 RKPFECSLCAYRSNWRWDITKHIRLKALRDRSHN---QAQVLMNDETGR---------------- 608
            .:||:|:.|::.:....:::||::      :.|.   :.:.|...:|||                
Human   368 DRPFKCNYCSFDTKQPSNLSKHMK------KFHGDMVKTEALERKDTGRQSSRQVAKLDAKKSFH 426

  Fly   609 ------------------RNYAKY----NQYLTMMKVSAEQLADSKGMRT----GEM-IVMPPEK 646
                              |.:::|    |..:|:::.   |:..||...|    |.: :.:.|.:
Human   427 CDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQF---QIDPSKQPATPLTVGHLQVPLQPSQ 488

  Fly   647 LDD-----------HHPMETEEIIEMVDSAHS--TSALDLRKPRDDQTEDLAGN----------- 687
            :..           |...:...|::...:|.:  ..||..:.|     |:|.||           
Human   489 VPQFSEGRVKIIVGHQVPQANTIVQAAAAAVNIVPPALVAQNP-----EELPGNSRLQILRQVSL 548

  Fly   688 -----SDELPQE-GAKTEPNL-----EPLSFKSLNSSQVMPKPKGSPMNLTKTDGGQSDETTS 739
                 |...|.| ||.|:|.:     |.....:|:.: ::|...|.|.   :..|.|:..|:|
Human   549 IAPPQSSRCPSEAGAMTQPAVLLTTHEQTDGATLHQT-LIPTASGGPQ---EGSGNQTFITSS 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 4/19 (21%)
C2H2 Zn finger 568..586 CDD:275370 4/17 (24%)
ZFP64NP_060667.2 COG5048 <151..450 CDD:227381 56/375 (15%)
zf-H2C2_2 161..186 CDD:290200 6/32 (19%)
C2H2 Zn finger 177..197 CDD:275368 4/19 (21%)
zf-H2C2_2 190..211 CDD:290200 7/20 (35%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
zf-H2C2_2 217..239 CDD:290200 7/21 (33%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 261..281 CDD:275368 0/19 (0%)
zf-H2C2_2 273..297 CDD:290200 7/45 (16%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 373..391 CDD:275368 4/17 (24%)
zf-C2H2_6 425..450 CDD:290623 1/24 (4%)
C2H2 Zn finger 427..447 CDD:275368 1/19 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.