DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmg and CG6254

DIOPT Version :9

Sequence 1:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:639 Identity:115/639 - (17%)
Similarity:197/639 - (30%) Gaps:239/639 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KLCLYASRHFQK---LVRHMKMVHGCSDDGGAVQGSGAQPRGKRNLSREVRKRRLEESIEGQGAT 211
            |.||...:.|.|   ::.....:.|..::               .|..:|.:...||.:|     
  Fly   174 KQCLQEKQDFPKEEDVIEEEMQISGVEEE---------------ILEEDVEEDLAEEEVE----- 218

  Fly   212 GQCLDLSVLRMIQN-GPPLEQLKVELQQQEMQ--LLASVQAYNRQQEMLQLQQIVESHDNIFSM- 272
                  :|...|.. |..:|.::.||:.|:..  |:..|:.....:.:.:.|.|.||..:.|:| 
  Fly   219 ------TVEEEIDTVGEEVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNME 277

  Fly   273 AYEFQTKLMPPKQAESLK--LEQQNSSSDSEETAKSPSPDTRELVSGKE--------QFQCQKCS 327
            .||. .:..|.|:....|  :|...|:.|::|..      :||.|:.:|        .::|..|.
  Fly   278 TYEI-VQHNPQKEPVETKDTVESIESNEDTQEDI------SREHVTDEEDEISEVPAMYKCNICK 335

  Fly   328 --YSTPIRARFKKHV-KYHS-----MPLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSCCDFS 384
              |..|  ..:|:|: :.|:     :|.::|:.|....|....|..|.:.|              
  Fly   336 KPYKKP--KAYKRHMEEVHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTH-------------- 384

  Fly   385 TDIKQSLTIHESNHHVPMPVHQMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTESLLPRT 449
                                                    ...||:|..                
  Fly   385 ----------------------------------------VRAKPKTDN---------------- 393

  Fly   450 SGIVCSHCQKRVGNAMQLINHLQVCTLALHNTTQLQASINAEVDLHDEDFPNAPTDLSYCGVETA 514
               .|.||:||...:..|..|::    .:||..:                   |.....||    
  Fly   394 ---CCPHCEKRFTTSGTLKRHIE----GIHNQIK-------------------PYVCDLCG---- 428

  Fly   515 PGYGEVTEVLPEE--PEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLNRKPFECSLCAYRSNW 577
            ..:..:|.:...:  ..|..|    |:||.|.......:|..:|:..| :.:.:||::|..:...
  Fly   429 KSFNYITGLKDHKLVHTDECP----FECPVCKRGFKNNARLKIHLDTH-SAEIYECTVCGLKLKT 488

  Fly   578 RWDITKH-------------------IRLKALRDRSHNQAQVLMNDETGRRNYAKYNQYLTMMKV 623
            |....||                   .|.|.|:      |.::::  ||.|.| |.|       .
  Fly   489 RRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLK------AHLILH--TGIRPY-KCN-------F 537

  Fly   624 SAEQLADSKGMRTGEMIVMPPEKLDDH-HPMETEEIIEMVDSAHSTSALDLRKPRDDQTEDLAGN 687
            .....|:....|:.:....|.|..::. ..:....::.|:|.....|.| |:.|        || 
  Fly   538 CGRDFANGSNCRSHKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKL-LKTP--------AG- 592

  Fly   688 SDELPQEGAKTEPNLEPLSFKSLNSSQVMPKPKGSPMNLTKTDGGQSDETTSAD 741
                            |...|.       .:||.:|.:   .|.|....|...|
  Fly   593 ----------------PCKVKG-------SRPKAAPKD---QDNGNESPTKDTD 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 5/19 (26%)
C2H2 Zn finger 568..586 CDD:275370 5/36 (14%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 50/321 (16%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 7/24 (29%)
C2H2 Zn finger 424..444 CDD:275368 3/23 (13%)
C2H2 Zn finger 452..472 CDD:275368 5/19 (26%)
C2H2 Zn finger 479..499 CDD:275368 5/19 (26%)
C2H2 Zn finger 507..527 CDD:275368 4/25 (16%)
zf-H2C2_2 520..544 CDD:290200 8/39 (21%)
C2H2 Zn finger 535..553 CDD:275368 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.