Sequence 1: | NP_609604.1 | Gene: | kmg / 34706 | FlyBaseID: | FBgn0032473 | Length: | 747 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012110.1 | Gene: | Zfp513 / 313913 | RGDID: | 1310456 | Length: | 541 | Species: | Rattus norvegicus |
Alignment Length: | 360 | Identity: | 69/360 - (19%) |
---|---|---|---|
Similarity: | 109/360 - (30%) | Gaps: | 124/360 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 321 FQCQKCSYSTPIRARFKKHVKYHS--MPLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSCCDF 383
Fly 384 STDIKQSLTIHESNH---------------------HVPMPVHQMG---NRSRD----------- 413
Fly 414 ----------------EAEDLVD----------------------QQSSGSRKPETF-------K 433
Fly 434 NGGATVASTESLLPRTSGIVCSHCQKRVGNAMQLINHLQV--------CTLALHNTTQLQASINA 490
Fly 491 EVDLHDEDFP-NAPTDLSYCGVETAPGYGEVTEVLPEEPEDLAPLK---------KVFKCPHCSF 545
Fly 546 WAATASRFHVHIVGHLNRKPFECSLCAYRSNWRWD 580 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kmg | NP_609604.1 | C2H2 Zn finger | 540..560 | CDD:275370 | 3/19 (16%) |
C2H2 Zn finger | 568..586 | CDD:275370 | 6/13 (46%) | ||
Zfp513 | NP_001012110.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..120 | ||
C2H2 Zn finger | 152..172 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 164..189 | CDD:290200 | 7/25 (28%) | ||
COG5048 | 176..>228 | CDD:227381 | 14/52 (27%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 192..217 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 362..382 | CDD:275368 | 5/19 (26%) | ||
COG5048 | <372..>450 | CDD:227381 | 16/97 (16%) | ||
zf-H2C2_2 | 374..399 | CDD:290200 | 3/24 (13%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 2/20 (10%) | ||
zf-H2C2_2 | 402..425 | CDD:290200 | 3/22 (14%) | ||
COG5048 | 414..>487 | CDD:227381 | 23/92 (25%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/38 (18%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 458..481 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 474..493 | CDD:275368 | 6/13 (46%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 492..541 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24403 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |