DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmg and Zfp91

DIOPT Version :9

Sequence 1:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001162591.1 Gene:Zfp91 / 246282 RGDID:628736 Length:568 Species:Rattus norvegicus


Alignment Length:626 Identity:112/626 - (17%)
Similarity:206/626 - (32%) Gaps:201/626 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KMVHGCSDDGGAVQGSGAQPRGKRNLSREVRKRRLEES---IEGQG-----------ATG----- 212
            :::.|..|.|.....:.|....:|..:...|:||...|   .:|.|           |.|     
  Rat    48 RVLRGGRDRGRTAAAAAAAAVSRRRKAEYPRRRRSSPSNRPPDGHGHQPAAAKPPSPAQGKKSPR 112

  Fly   213 -QCLDLSVLRMIQNGPPLEQLKVE-LQQQEMQLLASVQAYN-RQQEMLQLQQIVESHDNIFSMAY 274
             ||::    ::..:..|.|:.:.: :..||:.:.|:..:.: |......:.::.:|.:...|.:.
  Rat   113 LQCIE----KITTDKDPKEEKEDDSVLPQEVSITATRPSRSWRSSSRTSISRLRDSENTRSSRSK 173

  Fly   275 EFQTKLMPPKQAESLKL-----EQQNS----SSDSEETAKSPSPDTRELVSGKEQFQCQKCSYST 330
            ....:|:...:..:.:|     |:..|    |||.||       :..|::..:|:..        
  Rat   174 TGSLQLVCKTEPITDQLDYDVPEEHQSPSGISSDEEE-------EEEEMLISEEEIP-------- 223

  Fly   331 PIRARFKKHVKYHSMPLIKCSSCDFHTPYKWNLDRHT-KNHGANGHFKCSCCDFSTDIKQSLTIH 394
                 ||...:..:              ||.:|:|.| |....:|..|.........::..:.:.
  Rat   224 -----FKDDPRDET--------------YKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVK 269

  Fly   395 ESNHHV---PMPVHQMGNRSRDEAEDLVDQQSSGSRKPE------TFKNGGATVA---------S 441
            |..:.:   ..|..:.|.|.:|:....:.::   .:||.      ..:..|..:|         .
  Rat   270 EEENEIREDEEPPRKRGRRRKDDKSPRLPKR---RKKPPIQYVRCEMEGCGTVLAHPRYLQHHIK 331

  Fly   442 TESLLPRTSGIVCSH--CQKRVGNAMQLINHLQVCTLALHNTTQLQASINAEVDLHDEDFPNAPT 504
            .:.||.:.  .||.|  |.:......||:.|      |.|:|.|             .|:     
  Rat   332 YQHLLKKK--YVCPHPSCGRLFRLQKQLLRH------AKHHTDQ-------------RDY----- 370

  Fly   505 DLSYCGVETAPGYGEVTEVLPEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLNRKPFECS 569
            ...||.                         :.||..|         ...||.:.|...||.:|.
  Rat   371 ICEYCA-------------------------RAFKSSH---------NLAVHRMIHTGEKPLQCE 401

  Fly   570 LCAY----RSNWRWDITKH--------------------IRLKALRDRSHNQAQVLMNDETGRRN 610
            :|.:    :::..|.:.||                    ..:.|.:.:||.:..:.   |....|
  Rat   402 ICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIA---EALAAN 463

  Fly   611 YAKYNQYLTMMKVSAEQL---ADSKGM----------RTGEMIVMPPEKLDDHHPMETEEIIEMV 662
            .........::..:.|.|   |||:|:          .:||.:::..|.:...:...||.:..|.
  Rat   464 AGALITSTDILGTNPEPLTQPADSQGLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMA 528

  Fly   663 DSAHSTSALDLRKPRDDQTEDLAGNSDELPQEGAKTEPNLE 703
            |     ..:.:.......||.|..|||.|   ||.||..:|
  Rat   529 D-----GKIFVGSGSSGGTEGLVMNSDIL---GATTEVLIE 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 3/19 (16%)
C2H2 Zn finger 568..586 CDD:275370 5/41 (12%)
Zfp91NP_001162591.1 zf-C2H2_8 311..388 CDD:292531 21/136 (15%)
C2H2 Zn finger 345..364 CDD:275368 5/24 (21%)
C2H2 Zn finger 372..392 CDD:275368 7/53 (13%)
zf-H2C2_2 384..409 CDD:290200 7/24 (29%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 430..446 CDD:275368 0/15 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.