DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmg and Zfp64

DIOPT Version :9

Sequence 1:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_033590.2 Gene:Zfp64 / 22722 MGIID:107342 Length:676 Species:Mus musculus


Alignment Length:587 Identity:102/587 - (17%)
Similarity:190/587 - (32%) Gaps:212/587 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ESHDN----IFSMAYEFQTK--LMPPKQAE------SLKLEQQNSSSDSEETAKSPSPDTRELVS 316
            ||.||    :.|:..:.:||  ..||.|..      ..:.:......|.|...|        :.:
Mouse   112 ESTDNQTATVISLPTKSRTKKPTAPPAQKRLGCCYPGCQFKTAYGMKDMERHLK--------IHT 168

  Fly   317 GKEQFQCQKCSYSTPIRARFKKHVKYHS-MPLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSC 380
            |.:..:|:.|......:.:.|.|::.|: :...||.:||:......:|::|.:.|.....|||..
Mouse   169 GDKPHKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQI 233

  Fly   381 CDFSTDIKQSLTIHESNH--HVPMPVHQMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTE 443
            |.:::.....||:|..:|  ..|........:.:..::.....:.....||  ||          
Mouse   234 CPYASRNSSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKP--FK---------- 286

  Fly   444 SLLPRTSGIVCSHCQKRVGNAMQLINHLQV-----------C--------TLALHNTTQLQASIN 489
                      |..|..|......|.:|:::           |        ||..|:.        
Mouse   287 ----------CEFCNVRCTMKGNLKSHIRIKHSGNNFKCPHCDFLGDSKSTLRKHSR-------- 333

  Fly   490 AEVDLHDEDFPNAPTDLSYCGVETAPGYGEVTEVLPEEPEDLAPLKKVFKCPHCSFWAATASRFH 554
                ||..:.|.                                     |||.||:..::.:...
Mouse   334 ----LHQSEHPE-------------------------------------KCPECSYSCSSKAALR 357

  Fly   555 VHIVGHLNRKPFECSLCAYRSNWRWDITKHIRLKALRDRSHNQAQVLMND-----ETGR------ 608
            ||...|...:||:||.|::.:....:::||::      :.|  |.:|.|:     |:||      
Mouse   358 VHERIHCTERPFKCSYCSFDTKQPSNLSKHMK------KFH--ADMLKNEAPEKKESGRQSSRQV 414

  Fly   609 ----------------------------RNYAKY---NQYLTMMKVSAEQLADSKGMRTGEMIVM 642
                                        |.:::|   |..:|::::..|.........|.|.|.:
Mouse   415 ARLDAKKTFHCDICDASFMREDSLRSHKRQHSEYHSKNSDVTVVQLHLEPSKQPAAPLTVEQIQV 479

  Fly   643 PPEK-------------LDDHHPMETEEIIEMVDSAHSTSALDLRKPR--DDQTEDLAGN----- 687
            |.:.             :..|...:|..|::.     :.:|:::..|.  ....|::.||     
Mouse   480 PLQSSQVPQFSEGRVKIIVGHQVPQTNAIVQA-----AAAAVNIVPPTLVAQTPEEIPGNGRLQI 539

  Fly   688 -----------SDELPQE-GAKTEPNL-----EPLSFKSLNSSQVMPKPKGSPMNLTKTDGGQSD 735
                       |...|.| ||.::|.:     :..:..:|..:.:...|.|       |..|..:
Mouse   540 LRQVSLIAPPQSSGCPGEAGALSQPTVLLTTHDQTAGAALQQALIPTTPVG-------TQEGTGN 597

  Fly   736 ET 737
            :|
Mouse   598 QT 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 6/19 (32%)
C2H2 Zn finger 568..586 CDD:275370 5/17 (29%)
Zfp64NP_033590.2 COG5048 <149..448 CDD:227381 64/385 (17%)
zf-H2C2_2 159..184 CDD:290200 6/32 (19%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
zf-H2C2_2 188..209 CDD:290200 7/20 (35%)
C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
zf-H2C2_2 215..237 CDD:290200 7/21 (33%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..279 CDD:275368 0/19 (0%)
zf-H2C2_2 271..295 CDD:290200 7/45 (16%)
C2H2 Zn finger 287..306 CDD:275368 5/18 (28%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
zf-H2C2_2 355..380 CDD:290200 8/24 (33%)
C2H2 Zn finger 371..389 CDD:275368 5/17 (29%)
zf-C2H2_6 422..448 CDD:290623 1/25 (4%)
C2H2 Zn finger 425..445 CDD:275368 1/19 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.