DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmg and row-1

DIOPT Version :9

Sequence 1:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001122473.1 Gene:row-1 / 172928 WormBaseID:WBGene00009508 Length:584 Species:Caenorhabditis elegans


Alignment Length:291 Identity:58/291 - (19%)
Similarity:97/291 - (33%) Gaps:84/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VSGKEQFQCQKCSYSTPIRARFKKH-VKYHS--MPLIKCSSCDFHTPYKWNLDR----------- 365
            :||:..:.||||.|.|.:||.|.:| ::.||  ...:.|..|..|...:.|:.|           
 Worm   296 ISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNDSRTLLCPICLHHEDLRPNVRRSKHIFVREFVN 360

  Fly   366 HTKNHGANGHFKCSCCDFSTDIKQSLTIHESNHHVPM----------PVHQM------------- 407
            |.::|......:|..|..:...:..|..|.:|.|..:          .||:.             
 Worm   361 HMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDHTMLNSLWQVIERKSVHETEREHMSKRNKIGL 425

  Fly   408 ----------GNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTESLLPRTSGIVCSHCQKRVG 462
                      |.|..||.....|::..|.....|    |.|:...|             |..:..
 Worm   426 LQRRFFETLEGRRINDEVACAGDKEREGFDLTTT----GDTLFECE-------------CGFKSW 473

  Fly   463 NAMQLINHLQVCTLALHNTTQLQASINAEVDLHDE-----DFPNAPTDLSYCGVETAPG------ 516
            |..:..:|...|..::::..:.:..:....|..:|     .:|. ||:..   .||...      
 Worm   474 NGNRTASHYHKCRRSINDIERKREIVRLGSDPKEELELFAVYPQ-PTNTE---AETEEATLRKIH 534

  Fly   517 --YGEVTEVLPE---EPEDLAPLKKVFKCPH 542
              .|:...:|.:   :|.|..||.|:....|
 Worm   535 LERGDPLPILEDIVYQPIDDLPLLKMLSKNH 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 1/3 (33%)
C2H2 Zn finger 568..586 CDD:275370
row-1NP_001122473.1 GAT1 <15..288 CDD:227928
C2H2 Zn finger 244..265 CDD:275368
C2H2 Zn finger 275..295 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.