DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and YGK3

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_014513.1 Gene:YGK3 / 853992 SGDID:S000005488 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:105/340 - (30%)
Similarity:162/340 - (47%) Gaps:56/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IGSGSFGRVYQAHVNESEEI-----VAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRLIM----HS 105
            ||.||||.|.|: :..|..|     .|:|:.:.:||:...|.||:..:: |.|:|.|..    |.
Yeast    47 IGHGSFGTVTQS-ILSSNSIEWLGPYAIKRVVKSPKVQSLELEILQNIR-HPNLVTLEFFFESHC 109

  Fly   106 SVSLG-------FPSVDYVLLVMEYMPMTLLDYINYHLT--VLQPAERLINVRILSYQMFRGLGY 161
            :...|       |        ||||:|.||...|:.:..  ...|.:   ::::.::|:.|.|..
Yeast   110 TTKDGGHLYQKNF--------VMEYIPQTLSSEIHEYFDNGSKMPTK---HIKLYTFQILRALLT 163

  Fly   162 LHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSC 226
            ||.:.|.|.|:||.|:||.....:.|:.|||||:.|.......:|.|||.||||||....:.|:.
Yeast   164 LHSMSICHGDLKPSNILIIPSSGIAKVCDFGSAQRLDDNTELKTYFCSRFYRAPELLLNSKDYTT 228

  Fly   227 AVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLG---TDGLERAPEILSKCGNSLHPRTT 288
            .:||||.||::.|::||.|||.....: .||..|..:||   ...::.:.|:    .:||:.:..
Yeast   229 QIDIWSLGCIIGEMIKGQPLFKGDSAN-SQLEEIAKLLGRFPKSSIKNSQEL----QDSLNDQKF 288

  Fly   289 R------PSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNG 347
            :      ||..:.       |:..|| ....|:|..|.......:|..:|.|| .:...||..:.
Yeast   289 KKFMHWFPSIEFF-------DVEFLL-KVLTYDATERCDARQLMAHEFFDALR-NETYFLPRGSS 344

  Fly   348 NP--LPPLFDFNSLE 360
            .|  ||.||:|::.|
Yeast   345 MPVHLPDLFNFSASE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 94/310 (30%)
S_TKc 45..328 CDD:214567 92/304 (30%)
YGK3NP_014513.1 STKc_GSK3 35..332 CDD:271039 94/310 (30%)
S_TKc 44..329 CDD:214567 93/307 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.