DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and MRK1

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_010204.1 Gene:MRK1 / 851480 SGDID:S000002237 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:111/345 - (32%)
Similarity:163/345 - (47%) Gaps:60/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRLIMHSSVSLGFP 112
            :::|.||||.|....:.|:.:.||:|:.|.:.:....|.|.|..| .|.|.|.|..:      |.
Yeast   168 EVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKNRELETMKML-CHPNTVGLQYY------FY 225

  Fly   113 SVD-----YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLH-LLGISHRD 171
            ..|     |:.||::|||.:|...:.:.:.:.....| :.::..:||:|:.|.||| :..|.|||
Yeast   226 EKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPR-VEIKFYAYQLFKALNYLHNVPRICHRD 289

  Fly   172 VKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCV 236
            :||:|||:|......|:.||||||.|.|.:|::||||||.||||||..|...||..||:||:.||
Yeast   290 IKPQNLLVDPTTFSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGATNYSNQVDVWSSACV 354

  Fly   237 LAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCG-------NSLHPR-------T 287
            :||||.|.||||                |..|:::..||:...|       :.::|.       .
Yeast   355 IAELLLGKPLFS----------------GESGIDQLVEIIKIMGIPTKDEISGMNPNYEDHVFPN 403

  Fly   288 TRPSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMD------AMALPMPN 346
            .:|.....:..|...|...||.....|....|:.|:.......:||.:..|      |..|    
Yeast   404 IKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQCLLSSYFDETKRCDTDTYVKAQNL---- 464

  Fly   347 GNPLPPLFDFN-SLEMGTDP 365
                 .:|||: ..|:|..|
Yeast   465 -----RIFDFDVETELGHVP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 101/305 (33%)
S_TKc 45..328 CDD:214567 100/299 (33%)
MRK1NP_010204.1 STKc_GSK3 159..449 CDD:271039 100/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.