DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pk34A and CDKD1;1

DIOPT Version :9

Sequence 1:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_177510.1 Gene:CDKD1;1 / 843704 AraportID:AT1G73690 Length:398 Species:Arabidopsis thaliana


Alignment Length:310 Identity:99/310 - (31%)
Similarity:149/310 - (48%) Gaps:28/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQG-------EAEIMGQLKDHNNIVRLIMH 104
            ::::|.|::|.|::|...::.|.||:|:.... |..:|       |.:::.:|| |.:|:.||. 
plant    14 REVLGQGTYGVVFKATDTKNGETVAIKKIRLG-KEKEGVNVTALREIKLLKELK-HPHIIELID- 75

  Fly   105 SSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSY--QMFRGLGYLHLLGI 167
                 .||..:.:.:|.|:|...|...|......|.|.:      :.||  .:.:||.|.|...:
plant    76 -----AFPHKENLHIVFEFMETDLEAVIRDRNLYLSPGD------VKSYLQMILKGLEYCHGKWV 129

  Fly   168 SHRDVKPENLLIDNQKMVLKLSDFGSAKLL-VPQEPSISYICSRLYRAPELFAGYELYSCAVDIW 231
            .|||:||.||||..... |||:|||.|::. .|.......:.:|.||||||..|.:.|..|||:|
plant   130 LHRDMKPNNLLIGPNGQ-LKLADFGLARIFGSPGRKFTHQVFARWYRAPELLFGAKQYDGAVDVW 193

  Fly   232 SAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLL 296
            :|||:.||||...| |.....|..||..|....||...::.|:::.......:.....||...||
plant   194 AAGCIFAELLLRRP-FLQGNSDIDQLSKIFAAFGTPKADQWPDMICLPDYVEYQFVPAPSLRSLL 257

  Fly   297 NTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDEL-RIMDAMALPMP 345
            .| |.:|...||:..|.|:..:|||...|..|..:... ...|.:.||.|
plant   258 PT-VSEDALDLLSKMFTYDPKSRISIQQALKHRYFTSAPSPTDPLKLPRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 95/296 (32%)
S_TKc 45..328 CDD:214567 94/290 (32%)
CDKD1;1NP_177510.1 STKc_CDK7 10..304 CDD:270833 96/306 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.